RegulonDB RegulonDB 10.9: Gene Form
   

insL2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insL2 entD hokE insLp5 insLp5

Gene      
Name: insL2    Texpresso search in the literature
Synonym(s): ECK0016, G6327, b0582, yi81-2
Genome position(nucleotides): 608065 --> 609177 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.93
External database links:  
ASAP:
ABE-0002007
ECOLIHUB:
insL-2
OU-MICROARRAY:
b0582
STRING:
511145.b2394
COLOMBOS: insL2


Product      
Name: IS186/IS421 transposase
Synonym(s): InsL2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.909
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
107 -> 348 SGKRLRLVDGTAISAPGGGSAEWRLHMGYDPHTCQFTDFELTDSRDAERLDRFAQTADEIRIADRGFGSRPECIRSLAFGEADYIVRVHWRGLRWLTAEGMRFDMMGFLRGLDCGKNGETTVMIGNSGNKKAGAPFPARLIAVSLPPEKALISKTRLLSENRRKGRVVQAETLEAAGHVLLLTSLPEDEYSAEQVADCYRLRWQIELAFKRLKSLLHLDALRAKEPELAKAWIFANLLAAFL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
MONOMER0-4232
ECOLIWIKI:
b0582
INTERPRO:
IPR002559
INTERPRO:
IPR012337
INTERPRO:
IPR014736
PFAM:
PF01609
PRIDE:
P0CF92
REFSEQ:
NP_415114
UNIPROT:
P0CF92


Operon      
Name: insL2         
Operon arrangement:
Transcription unit        Promoter
insL2


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insLp5 608056 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB