RegulonDB RegulonDB 10.9: Gene Form
   

rnk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rna unknown rnk yldA anti-anti-terminator anti-terminator terminator rnkp7 rnkp7 rnkp6 rnkp6

Gene      
Name: rnk    Texpresso search in the literature
Synonym(s): ECK0603, G6337, b0610
Genome position(nucleotides): 643557 <-- 643967 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.74
External database links:  
ASAP:
ABE-0002104
ECHOBASE:
EB2518
ECOLIHUB:
rnk
OU-MICROARRAY:
b0610
STRING:
511145.b0610
COLOMBOS: rnk


Product      
Name: nucleoside diphosphate kinase regulator
Synonym(s): Rnk
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.927
Isoelectric point: 4.228
Motif(s):
 
Type Positions Sequence
4 -> 42 PTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQ
50 -> 126 PHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSIHWELPGGVATHLEVLELEY

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0070063 - RNA polymerase binding
GO:0001000 - bacterial-type RNA polymerase core enzyme binding
biological_process GO:0032784 - regulation of DNA-templated transcription, elongation
GO:0006354 - DNA-templated transcription, elongation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Lamour V., et al., 2008
[2] Shankar S., et al., 1995
External database links:  
DIP:
DIP-48048N
ECOCYC:
G6337-MONOMER
ECOLIWIKI:
b0610
INTERPRO:
IPR001437
INTERPRO:
IPR029462
INTERPRO:
IPR036953
INTERPRO:
IPR023459
INTERPRO:
IPR028625
MODBASE:
P0AFW4
PANTHER:
PTHR30437
PDB:
3BMB
PFAM:
PF01272
PFAM:
PF14760
PRIDE:
P0AFW4
PRODB:
PRO_000023797
REFSEQ:
NP_415143
SMR:
P0AFW4
UNIPROT:
P0AFW4


Operon      
Name: rnk         
Operon arrangement:
Transcription unit        Promoter
rnk


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rnkp6 644055 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rnkp7 644180 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lamour V., Rutherford ST., Kuznedelov K., Ramagopal UA., Gourse RL., Severinov K., Darst SA., 2008, Crystal structure of Escherichia coli Rnk, a new RNA polymerase-interacting protein., J Mol Biol 383(2):367-79

 [2] Shankar S., Schlictman D., Chakrabarty AM., 1995, Regulation of nucleoside diphosphate kinase and an alternative kinase in Escherichia coli: role of the sspA and rnk genes in nucleoside triphosphate formation., Mol Microbiol 17(5):935-43

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB