RegulonDB RegulonDB 10.8: Gene Form
   

citC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: citC    Texpresso search in the literature
Synonym(s): ECK0611, G6344, b0618, ybeO
Genome position(nucleotides): 650798 <-- 651856 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.9
External database links:  
ASAP:
ABE-0002126
ECHOBASE:
EB3409
OU-MICROARRAY:
b0618
PortEco:
citC
STRING:
511145.b0618
COLOMBOS: citC


Product      
Name: citrate lyase synthetase
Synonym(s): CitC, YbeO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.077
Isoelectric point: 8.214
Motif(s):
 
Type Positions Sequence
147 -> 333 IGCIVMNANPFTNGHRYLIQQAAAQCDWLHLFLVKEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEIDLKIFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLETPTISAPPIELVEIERLRYQEMPISASRVRQLLAKNDLTAIAPLVPAVTLHYL
1 -> 128 MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRDEKLIACGGIAGNIIKCVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEALFRQCGFSTLTSVPGVMVLMENSAT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0008080 - N-acetyltransferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008771 - [citrate (pro-3S)-lyase] ligase activity
biological_process GO:0006464 - cellular protein modification process
GO:0009058 - biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CITC-MONOMER
ECOLIWIKI:
b0618
INTERPRO:
IPR004821
INTERPRO:
IPR016181
INTERPRO:
IPR014729
INTERPRO:
IPR013166
INTERPRO:
IPR005216
INTERPRO:
IPR000182
MODBASE:
P77390
PANTHER:
PTHR40599
PFAM:
PF08218
PRIDE:
P77390
PRODB:
PRO_000022288
PROSITE:
PS51186
REFSEQ:
NP_415151
SMART:
SM00764
SMR:
P77390
UNIPROT:
P77390


Operon      
Name: citCDEFXG         
Operon arrangement:
Transcription unit        Promoter
citCDEFXG
citCDEFXG


Transcriptional Regulation      
Display Regulation             
Activated by: DpiA
Repressed by: CRP, FNR, ArcA, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB