RegulonDB RegulonDB 10.9: Gene Form
   

dpiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dpiB dcuC citC dpiA NarL DcuR DpiA DpiA DcuR DpiA FNR CRP NarL ArcA dpiBp2 dpiBp2 citCp2 citCp2 dpiBp dpiBp citCp1 citCp1

Gene      
Name: dpiB    Texpresso search in the literature
Synonym(s): ECK0612, G6345, b0619, citA, mpdB, ybeP
Genome position(nucleotides): 652235 --> 653893 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.09
External database links:  
ASAP:
ABE-0002129
ECHOBASE:
EB3410
ECOLIHUB:
dpiB
OU-MICROARRAY:
b0619
STRING:
511145.b0619
COLOMBOS: dpiB


Product      
Name: sensor histidine kinase DpiB
Synonym(s): CitA, DpiB, MpdB, YbeP
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol,inner membrane
Molecular weight: 61.684
Isoelectric point: 5.944
Motif(s):
 
Type Positions Sequence
517 -> 517 C
429 -> 539 DSTEFAAIVGNLLDNAFEASLRSDEGNKIVELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRCGGVITLEDNDPCGTLFSIYIPK
61 -> 173 AKIIASNDSVISAVKTRDYKRLATIANKLQRDTDFDYVVIGDRHSIRLYHPNPEKIGYPMQFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVVSIGYLVSKID
330 -> 373 AQLTQIKQYVESLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQ
138 -> 138 G

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0009927 - histidine phosphotransfer kinase activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Herring CD., et al., 2003
[2] Yamamoto K., et al., 2005
External database links:  
ECOCYC:
G6345-MONOMER
ECOLIWIKI:
b0619
INTERPRO:
IPR000014
INTERPRO:
IPR003594
INTERPRO:
IPR035965
INTERPRO:
IPR005467
INTERPRO:
IPR013767
INTERPRO:
IPR016120
INTERPRO:
IPR029151
INTERPRO:
IPR033463
INTERPRO:
IPR036890
INTERPRO:
IPR039506
INTERPRO:
IPR004358
MODBASE:
P77510
PFAM:
PF14689
PFAM:
PF17203
PFAM:
PF00989
PFAM:
PF02518
PRIDE:
P77510
PRINTS:
PR00344
PRODB:
PRO_000022472
PROSITE:
PS50109
REFSEQ:
NP_415152
SMART:
SM00091
SMART:
SM00387
SMR:
P77510
UNIPROT:
P77510


Operon      
Name: dpiBA         
Operon arrangement:
Transcription unit        Promoter
dpiBA
dpiBA


Transcriptional Regulation      
Display Regulation             
Activated by: DpiA, DcuR, ArcA
Repressed by: CRP, FNR, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Herring CD., Glasner JD., Blattner FR., 2003, Gene replacement without selection: regulated suppression of amber mutations in Escherichia coli., Gene 311:153-63

 [2] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A., 2005, Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli., J Biol Chem 280(2):1448-56


RegulonDB