RegulonDB RegulonDB 10.8: Gene Form
   

dpiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dpiB dcuC citC dpiA NarL DcuR DpiA DpiA DcuR DpiA FNR CRP NarL ArcA dpiBp2 dpiBp2 citCp2 citCp2 dpiBp dpiBp citCp1 citCp1

Gene      
Name: dpiA    Texpresso search in the literature
Synonym(s): ECK0613, G6346, b0620, citB, criR, mpdA
Genome position(nucleotides): 653862 --> 654542 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.51
External database links:  
ASAP:
ABE-0002131
ECHOBASE:
EB3314
OU-MICROARRAY:
b0620
PortEco:
dpiA
STRING:
511145.b0620
COLOMBOS: dpiA


Product      
Name: DNA-binding transcriptional dual regulator DpiA
Synonym(s): CitB, CriR, DpiA, DpiA response regulator, MpdA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HTH_11
Cellular location: cytosol
Molecular weight: 25.453
Isoelectric point: 7.029
Motif(s):
 
Type Positions Sequence
8 -> 117 LIVEDETPLAEMHAEYIRHIPGFSQILLAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDYLIKPIAYERLGQT
180 -> 199 AETVAQALTISRTTARRYLE
134 -> 160 ASQKQIDEMFNAYARGEPKDELPTGID
6 -> 122 TLLIVEDETPLAEMHAEYIRHIPGFSQILLAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDYLIKPIAYERLGQTLTRFR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
biological_process GO:0000160 - phosphorelay signal transduction system
External database links:  
DIP:
DIP-47831N
ECOCYC:
G6346-MONOMER
ECOLIWIKI:
b0620
INTERPRO:
IPR001789
INTERPRO:
IPR028141
INTERPRO:
IPR024187
INTERPRO:
IPR011006
MINT:
MINT-1286196
MODBASE:
P0AEF4
PANTHER:
PTHR45526
PFAM:
PF12431
PFAM:
PF00072
PRIDE:
P0AEF4
PRODB:
PRO_000022471
PROSITE:
PS50110
REFSEQ:
NP_415153
SMART:
SM00448
SMR:
P0AEF4
UNIPROT:
P0AEF4


Operon      
Name: dpiBA         
Operon arrangement:
Transcription unit        Promoter
dpiBA
dpiBA


Transcriptional Regulation      
Display Regulation             
Activated by: DpiA, DcuR, ArcA
Repressed by: CRP, FNR, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB