RegulonDB RegulonDB 10.9: Gene Form
   

cobC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nadD cobC rsfS cobCp6 cobCp6 cobCp7 cobCp7 rsfSp rsfSp

Gene      
Name: cobC    Texpresso search in the literature
Synonym(s): ECK0631, G6349, b0638, phpB
Genome position(nucleotides): 669296 <-- 669907 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.14
External database links:  
ASAP:
ABE-0002185
ECHOBASE:
EB3029
ECOLIHUB:
cobC
OU-MICROARRAY:
b0638
STRING:
511145.b0638
COLOMBOS: cobC


Product      
Name: putative adenosylcobalamin phosphatase/α-ribazole phosphatase
Synonym(s): CobC, PhpB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.308
Isoelectric point: 6.275
Motif(s):
 
Type Positions Sequence
3 -> 194 LWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLHGVSFDLVLCSELERAQHTARLVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEGFQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGMPAEAMWHFRVDQGCWSAIDINQKFATLRVLN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.13 - cobalamin
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016868 - intramolecular transferase activity, phosphotransferases
GO:0043755 - alpha-ribazole phosphatase activity
biological_process GO:0009236 - cobalamin biosynthetic process
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
RIBAZOLEPHOSPHAT-MONOMER
ECOLIWIKI:
b0638
INTERPRO:
IPR029033
INTERPRO:
IPR001345
INTERPRO:
IPR013078
INTERPRO:
IPR017578
MODBASE:
P52086
PDB:
6E4B
PFAM:
PF00300
PRIDE:
P52086
PRODB:
PRO_000022312
PROSITE:
PS00175
REFSEQ:
NP_415171
SMART:
SM00855
SMR:
P52086
UNIPROT:
P52086


Operon      
Name: leuS-lptE-holA-nadD-cobC         
Operon arrangement:
Transcription unit        Promoter
leuS-lptE-holA-nadD-cobC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cobCp7 669944 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter cobCp6 670046 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB