RegulonDB RegulonDB 10.8: Gene Form
   

nadD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

holA nadD cobC TSS_763 TSS_763 TSS_762 TSS_762 cobCp6 cobCp6 cobCp7 cobCp7

Gene      
Name: nadD    Texpresso search in the literature
Synonym(s): ECK0632, G6350, b0639, fusB, ybeN
Genome position(nucleotides): 669931 <-- 670572 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0002187
ECHOBASE:
EB3030
OU-MICROARRAY:
b0639
PortEco:
nadD
STRING:
511145.b0639
COLOMBOS: nadD


Product      
Name: nicotinate-mononucleotide adenylyltransferase
Synonym(s): FusB, NadD, YbeN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.528
Isoelectric point: 5.55
Motif(s):
 
Type Positions Sequence
7 -> 187 LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSVQRKHMLELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHLQPAGKIYLAETPWFNISATIIRER

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.7 - nicotinamide adenine dinucleotide
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000309 - nicotinamide-nucleotide adenylyltransferase activity
GO:0004515 - nicotinate-nucleotide adenylyltransferase activity
biological_process GO:0009058 - biosynthetic process
GO:0009435 - NAD biosynthetic process
GO:0019363 - pyridine nucleotide biosynthetic process
GO:0034355 - NAD salvage
GO:0034628 - 'de novo' NAD biosynthetic process from aspartate
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
NICONUCADENYLYLTRAN-MONOMER
ECOLIWIKI:
b0639
INTERPRO:
IPR004821
INTERPRO:
IPR014729
INTERPRO:
IPR005248
MODBASE:
P0A752
PANTHER:
PTHR12039
PDB:
1K4M
PDB:
1K4K
PFAM:
PF01467
PRIDE:
P0A752
PRODB:
PRO_000023334
REFSEQ:
NP_415172
SMR:
P0A752
UNIPROT:
P0A752


Operon      
Name: leuS-lptE-holA-nadD-cobC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cobCp7 669944 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter cobCp6 670046 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_762 670902 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_763 671450 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB