RegulonDB RegulonDB 10.8: Gene Form
   

ybeQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybeQ ybeR ybeL djlB ybeQp1 ybeQp1 ybeQp11 ybeQp11 ybeQp8 ybeQp8 ybeRp6 ybeRp6 ybeQp10 ybeQp10 ybeQp12 ybeQp12 ybeRp5 ybeRp5 ybeQp5 ybeQp5 ybeRp7 ybeRp7

Gene      
Name: ybeQ    Texpresso search in the literature
Synonym(s): ECK0637, G6351, b0644
Genome position(nucleotides): 675570 <-- 676547 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.03
External database links:  
ASAP:
ABE-0002201
ECHOBASE:
EB3411
OU-MICROARRAY:
b0644
PortEco:
ybeQ
STRING:
511145.b0644
COLOMBOS: ybeQ


Product      
Name: Sel1 repeat-containing protein YbeQ
Synonym(s): YbeQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 37.031
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
26 -> 61 EAQYIVGFYYNRDSAIDSPDDEKAFYWLKLAAEQGH
168 -> 203 SDAQNNLADLYEDGKGVAQNKTLAAFWYLKSAQQGN
242 -> 275 AYVNIGYMYKHGQGVEKDYQAAFEWFTKAAECND
280 -> 305 YNLAIMYHYGEGRPVDLRQALDLYRK
63 -> 97 EAQYSLGQKYTEDKSRHKDNEQAIFWLKKAALQGH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0008047 - enzyme activator activity
biological_process GO:0006979 - response to oxidative stress
GO:0043085 - positive regulation of catalytic activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6351-MONOMER
ECOLIWIKI:
b0644
INTERPRO:
IPR011990
INTERPRO:
IPR006597
MODBASE:
P77234
PFAM:
PF08238
PRIDE:
P77234
REFSEQ:
NP_415177
SMART:
SM00671
SMR:
P77234
UNIPROT:
P77234


Operon      
Name: ybeQ         
Operon arrangement:
Transcription unit        Promoter
ybeQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybeRp7 676560 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeQp5 676572 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeRp5 676590 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeQp12 676611 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeQp10 676624 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeRp6 676637 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeQp8 676639 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeQp11 676700 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeQp1 676706 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB