RegulonDB RegulonDB 10.8: Gene Form
   

ybeR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

djlB ybeQ ybeR ybeT ybeQp1 ybeQp1 ybeQp11 ybeQp11 ybeQp8 ybeQp8 ybeRp6 ybeRp6 ybeQp10 ybeQp10 ybeQp12 ybeQp12 ybeRp5 ybeRp5 ybeQp5 ybeQp5 ybeRp7 ybeRp7

Gene      
Name: ybeR    Texpresso search in the literature
Synonym(s): ECK0638, G6352, b0645
Genome position(nucleotides): 676711 --> 677418 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.76
External database links:  
ASAP:
ABE-0002208
ECHOBASE:
EB3412
OU-MICROARRAY:
b0645
PortEco:
ybeR
STRING:
511145.b0645
COLOMBOS: ybeR


Product      
Name: DUF1266 domain-containing protein YbeR
Synonym(s): YbeR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.736
Isoelectric point: 4.749
Motif(s):
 
Type Positions Sequence
41 -> 216 LSSSWGIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVASTAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFAGYTFGRQYWQSPEDDHLPLLREFLARKEYDDSGNDMFYQLFASDDAYYPTLSW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-11366N
ECOCYC:
G6352-MONOMER
ECOLIWIKI:
b0645
INTERPRO:
IPR009677
PFAM:
PF06889
PRIDE:
P77627
REFSEQ:
NP_415178
UNIPROT:
P77627


Operon      
Name: ybeR-djlB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybeRp7 676560 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp5 676572 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeRp5 676590 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp12 676611 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp10 676624 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeRp6 676637 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp8 676639 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp11 676700 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeQp1 676706 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB