RegulonDB RegulonDB 10.8: Gene Form
   

chiP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: chiP    Texpresso search in the literature
Synonym(s): ECK0669, G6370, b0681, ybfM
Genome position(nucleotides): 708334 --> 709740 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.24
External database links:  
ASAP:
ABE-0002323
ECHOBASE:
EB3423
OU-MICROARRAY:
b0681
PortEco:
chiP
STRING:
511145.b0681
COLOMBOS: chiP


Product      
Name: chitobiose outer membrane channel
Synonym(s): ChiP, YbfM
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 52.78
Isoelectric point: 4.622
Motif(s):
 
Type Positions Sequence
1 -> 32 MRTFSGKRSTLALAIAGVTAMSGFMAMPEARA
33 -> 468 EGFIDDSTLTGGIYYWQRERDRKDVTDGDKYKTNLSHSTWNANLDFQSGYAADMFGLDIAAFTAIEMAENGDSSHPNEIAFSKSNKAYDEDWSGDKSGISLYKAAAKFKYGPVWARAGYIQPTGQTLLAPHWSFMPGTYQGAEAGANFDYGDAGALSFSYMWTNEYKAPWHLEMDEFYQNDKTTKVDYLHSFGAKYDFKNNFVLEAAFGQAEGYIDQYFAKASYKFDIAGSPLTTSYQFYGTRDKVDDRSVNDLYDGTAWLQALTFGYRAADVVDLRLEGTWVKADGQQGYFLQRMTPTYASSNGRLDIWWDNRSDFNANGEKAVFFGAMYDLKNWNLPGFAIGASYVYAWDAKPATWQSNPDAYYDKNRTIEESAYSLDAVYTIQDGRAKGTMFKLHFTEYDNHSDIPSWGGGYGNIFQDERDVKFMVIAPFTIF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0046930 - pore complex
molecular_function GO:0015267 - channel activity
GO:0015288 - porin activity
biological_process GO:0006811 - ion transport
GO:0008643 - carbohydrate transport
GO:0015774 - polysaccharide transport
GO:0055085 - transmembrane transport
GO:0015772 - oligosaccharide transport
GO:0052778 - diacetylchitobiose metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Soysa HSM., et al., 2017
[2] Soysa HSM., et al., 2018
[3] Yang C., et al., 2006
External database links:  
ECOCYC:
G6370-MONOMER
ECOLIWIKI:
b0681
INTERPRO:
IPR005318
INTERPRO:
IPR023614
PANTHER:
PTHR34596
PFAM:
PF03573
PRIDE:
P75733
REFSEQ:
NP_415207
UNIPROT:
P75733


Operon      
Name: chiPQ         
Operon arrangement:
Transcription unit        Promoter
chiP-ybfN
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_811 706185 forward nd [RS-EPT-CBR] [4]
  promoter TSS_812 706250 reverse nd [RS-EPT-CBR] [4]



RegulonDB