RegulonDB RegulonDB 10.9: Gene Form
   

pxpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pxpC nei ybgI pxpA pxpB abrB neip neip TSS_836 TSS_836 TSS_835 (cluster) TSS_835 (cluster)

Gene      
Name: pxpC    Texpresso search in the literature
Synonym(s): ECK0701, G6381, b0712, ybgK
Genome position(nucleotides): 744243 --> 745175 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.52
External database links:  
ASAP:
ABE-0002428
ECHOBASE:
EB3091
ECOLIHUB:
ybgK
OU-MICROARRAY:
b0712
STRING:
511145.b0712
COLOMBOS: pxpC


Product      
Name: 5-oxoprolinase component C
Synonym(s): PxpC, YbgK, putative carboxyltransferase subunit YbgK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.386
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
25 -> 281 GISHCGALDMPALRIANLLVGNDANAPALEITLGQLTVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKRPQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLKDGDRLPIGKSKRDSMEAQGVKQLLWGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDRELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFV

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0017168 - 5-oxoprolinase (ATP-hydrolyzing) activity
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11397N
ECOCYC:
G6381-MONOMER
ECOLIWIKI:
b0712
INTERPRO:
IPR003778
INTERPRO:
IPR029000
PDB:
5DUD
PFAM:
PF02626
PRIDE:
P75745
REFSEQ:
NP_415240
SMART:
SM00797
SMR:
P75745
UNIPROT:
P75745


Operon      
Name: ybgI-pxpBCA-nei         
Operon arrangement:
Transcription unit        Promoter
ybgIJKL-nei
ybgIJKL-nei
nei


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_835 (cluster) 743357 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_836 743410 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB