RegulonDB RegulonDB 10.9: Gene Form
   

pxpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pxpC nei pxpA pxpB abrB neip neip

Gene      
Name: pxpA    Texpresso search in the literature
Synonym(s): ECK0702, G6382, b0713, ybgL
Genome position(nucleotides): 745165 --> 745899 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.69
External database links:  
ASAP:
ABE-0002431
ECHOBASE:
EB3092
ECOLIHUB:
ybgL
OU-MICROARRAY:
b0713
STRING:
511145.b0713
COLOMBOS: pxpA


Product      
Name: 5-oxoprolinase component A
Synonym(s): PxpA, YbgL, putative glycoside hydrolase YbgL, putative lactam utilization protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.8
Isoelectric point: 6.148
Motif(s):
 
Type Positions Sequence
3 -> 235 IDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQIMQACVREAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADRGYQADGSLVPRSQSGALIENEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGEHALAFARRLRSAF

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0017168 - 5-oxoprolinase (ATP-hydrolyzing) activity
GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006807 - nitrogen compound metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11398N
ECOCYC:
G6382-MONOMER
ECOLIWIKI:
b0713
INTERPRO:
IPR005501
INTERPRO:
IPR011330
PANTHER:
PTHR30292
PDB:
1XW8
PFAM:
PF03746
PRIDE:
P75746
REFSEQ:
NP_415241
SMR:
P75746
UNIPROT:
P75746


Operon      
Name: ybgI-pxpBCA-nei         
Operon arrangement:
Transcription unit        Promoter
ybgIJKL-nei
ybgIJKL-nei
nei


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB