RegulonDB RegulonDB 10.9: Gene Form
   

ybgO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybgQ ybgO abrB ybgP nei anti-terminator terminator ybgOp3 ybgOp3 ybgOp4 ybgOp4 TSS_838 TSS_838 TSS_837 TSS_837

Gene      
Name: ybgO    Texpresso search in the literature
Synonym(s): ECK0705, G6385, b0716
Genome position(nucleotides): 747921 <-- 748982 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.92
External database links:  
ASAP:
ABE-0002441
ECHOBASE:
EB3095
ECOLIHUB:
ybgO
OU-MICROARRAY:
b0716
STRING:
511145.b0716
COLOMBOS: ybgO


Product      
Name: putative fimbrial protein YbgO
Synonym(s): YbgO
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus
Molecular weight: 39.539
Isoelectric point: 4.647
Motif(s):
 
Type Positions Sequence
24 -> 353 LNCYFGTSGGAVEKSEAIQPFAVPGNAKPGDKIWESDDIKIPVYCDNNTNGNFESEHVYAWVNPYPGVQDRYYQLGVTYNGVDYDASLGKSRIDTNQCIDSKNIDIYTPEQIIAMGWQNKICSGDPANIHMSRTFLARMRLYVKIREMPPHDYQSTLSDYIVVQFDGAGSVNEDPTAQNLKYHITGLENIRVLDCSVNFSISPETQVIDFGKFNLLDIRRHTMSKTFSIKTTKSQNDQCTDGFKVSSSFYTEETLVEEDKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLVYEKTYTAELSSIPGTPIEAGPFDTVVLFKINYN
1 -> 23 MSAGKGLLLVICLLFLPLKSAMA
216 -> 352 LDCSVNFSISPETQVIDFGKFNLLDIRRHTMSKTFSIKTTKSQNDQCTDGFKVSSSFYTEETLVEEDKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLVYEKTYTAELSSIPGTPIEAGPFDTVVLFKINY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
biological_process GO:0007155 - cell adhesion
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[ICWHO] Inferred computationally without human oversight
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
[4] Zhai Y., et al., 2002
External database links:  
ECOCYC:
G6385-MONOMER
ECOLIWIKI:
b0716
INTERPRO:
IPR000259
INTERPRO:
IPR008966
INTERPRO:
IPR036937
PFAM:
PF00419
PRIDE:
P75748
REFSEQ:
NP_415244
SMR:
P75748
UNIPROT:
P75748


Operon      
Name: ybgQPO         
Operon arrangement:
Transcription unit        Promoter
ybgQPO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_837 747325 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_838 747803 reverse nd [RS-EPT-CBR] [5]
  promoter ybgOp4 749182 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter ybgOp3 749185 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB