RegulonDB RegulonDB 10.8: Gene Form
   

ybgP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybgQ ybgO abrB ybgP nei anti-terminator terminator ybgOp3 ybgOp3 ybgOp4 ybgOp4 TSS_838 TSS_838 TSS_837 TSS_837

Gene      
Name: ybgP    Texpresso search in the literature
Synonym(s): ECK0706, G6386, b0717
Genome position(nucleotides): 748979 <-- 749707 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.74
External database links:  
ASAP:
ABE-0002443
ECHOBASE:
EB3096
OU-MICROARRAY:
b0717
PortEco:
ybgP
STRING:
511145.b0717
COLOMBOS: ybgP


Product      
Name: putative fimbrial chaperone YbgP
Synonym(s): YbgP
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 26.954
Isoelectric point: 9.838
Motif(s):
 
Type Positions Sequence
21 -> 242 AVQPDRTRIVFNANDKATSLRIENQSDKLPYLAYSWIENEKGEKSDALLVALPPIQRLEPKATSQVRVVKQASTTQLPGDRETLFFYNMREIPPAPDKSSDHAILQVAIQSRIKLFWRPAALRKKAGEKVELQLQVSQQGNQLTLKNPTAYYLTIAYLGRNEKGVLPGFKTVMVAPFSTVNTNTGSYSGSQFYLGYMDDYGALRMTTLNCSGQCRLQAVEAK
1 -> 20 MTFIKGLPLMLLTISLGCNA
22 -> 142 VQPDRTRIVFNANDKATSLRIENQSDKLPYLAYSWIENEKGEKSDALLVALPPIQRLEPKATSQVRVVKQASTTQLPGDRETLFFYNMREIPPAPDKSSDHAILQVAIQSRIKLFWRPAAL
166 -> 222 KNPTAYYLTIAYLGRNEKGVLPGFKTVMVAPFSTVNTNTGSYSGSQFYLGYMDDYGA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006457 - protein folding
GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Korea CG., et al., 2010
[2] Zhai Y., et al., 2002
External database links:  
ECOCYC:
G6386-MONOMER
ECOLIWIKI:
b0717
INTERPRO:
IPR013783
INTERPRO:
IPR036316
INTERPRO:
IPR018046
INTERPRO:
IPR016148
INTERPRO:
IPR016147
INTERPRO:
IPR008962
INTERPRO:
IPR001829
MODBASE:
P75749
PFAM:
PF00345
PFAM:
PF02753
PRIDE:
P75749
PRINTS:
PR00969
PROSITE:
PS00635
REFSEQ:
NP_415245
SMR:
P75749
UNIPROT:
P75749


Operon      
Name: ybgQPO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_837 747325 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_838 747803 reverse nd [RS-EPT-CBR] [3]
  promoter ybgOp4 749182 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybgOp3 749185 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB