RegulonDB RegulonDB 10.8: Gene Form
   

ybgQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybgQ ybgP ybgD ybgO ybgOp3 ybgOp3 ybgOp4 ybgOp4

Gene      
Name: ybgQ    Texpresso search in the literature
Synonym(s): ECK0707, G6387, b0718
Genome position(nucleotides): 749722 <-- 752169 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.96
External database links:  
ASAP:
ABE-0002446
ECHOBASE:
EB3097
OU-MICROARRAY:
b0718
PortEco:
ybgQ
STRING:
511145.b0718
COLOMBOS: ybgQ


Product      
Name: putative fimbrial usher protein YbgQ
Synonym(s): YbgQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 90.128
Isoelectric point: 4.851
Motif(s):
 
Type Positions Sequence
23 -> 162 EFNLNVLDKSMRDRIDISLLKEKGVIAPGEYFVSVAVNNNKISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIRQSLPQIDRCIDFSSRPEMLFNFDQANQQLNISIPQAWLAWHSENWAPPSTWKEGVAGVLMDYNL
180 -> 730 AYGTAGINAGAWRLRSDYQLNKTDSEDNHDQSGGISRTYLFRPLPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVTISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQGQVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYGGLLISDDDYHSAAMGIGQNMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHSYANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAGFNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTIHRMSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAASDYSSVSSSWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSYQPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKS
743 -> 798 IRNASGQFPPLGADIRQDDSGISVGMVGEEGHAWLSGVAENQLFTVVWGEQSCIIH
1 -> 21 MNIYRLSFVSCLVMAMPCAMA
22 -> 815 VEFNLNVLDKSMRDRIDISLLKEKGVIAPGEYFVSVAVNNNKISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIRQSLPQIDRCIDFSSRPEMLFNFDQANQQLNISIPQAWLAWHSENWAPPSTWKEGVAGVLMDYNLFASSYRPQDGSSSTNLNAYGTAGINAGAWRLRSDYQLNKTDSEDNHDQSGGISRTYLFRPLPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVTISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQGQVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYGGLLISDDDYHSAAMGIGQNMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHSYANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAGFNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTIHRMSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAASDYSSVSSSWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSYQPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSGKDVNVIIRNASGQFPPLGADIRQDDSGISVGMVGEEGHAWLSGVAENQLFTVVWGEQSCIIHLPERLEDTTKRLILPCH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015473 - fimbrial usher porin activity
biological_process GO:0009297 - pilus assembly
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
DIP:
DIP-11401N
ECOCYC:
G6387-MONOMER
ECOLIWIKI:
b0718
INTERPRO:
IPR042186
INTERPRO:
IPR037224
INTERPRO:
IPR025949
INTERPRO:
IPR025885
INTERPRO:
IPR000015
INTERPRO:
IPR018030
MINT:
MINT-1307660
PANTHER:
PTHR30451
PFAM:
PF00577
PFAM:
PF13954
PFAM:
PF13953
PRIDE:
P75750
PROSITE:
PS01151
REFSEQ:
NP_415246
SMR:
P75750
UNIPROT:
P75750


Operon      
Name: ybgQPO         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybgOp4 749182 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybgOp3 749185 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB