RegulonDB RegulonDB 10.8: Gene Form
   

modE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

modF modE acrZ SoxS Rob MarA anti-anti-terminator anti-terminator anti-terminator terminator acrZp acrZp

Gene      
Name: modE    Texpresso search in the literature
Synonym(s): ECK0750, G6395, b0761, chlD, modR
Genome position(nucleotides): 793856 <-- 794644 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.6
External database links:  
ASAP:
ABE-0002585
ECHOBASE:
EB3017
OU-MICROARRAY:
b0761
PortEco:
modE
STRING:
511145.b0761
COLOMBOS: modE


Product      
Name: DNA-binding transcriptional dual regulator ModE
Synonym(s): ChlD, ModE, ModE-MoO42-, ModR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 28.281
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
1 -> 121 MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLNSLLAAISRF
33 -> 79 SISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLT
124 -> 191 QTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQ
133 -> 133 G
76 -> 76 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
GO:0003700 - DNA-binding transcription factor activity
GO:0030151 - molybdenum ion binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0015689 - molybdate ion transport
External database links:  
DIP:
DIP-10238N
ECOCYC:
MONOMER0-185
ECOLIWIKI:
b0761
INTERPRO:
IPR003725
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR016462
INTERPRO:
IPR008995
INTERPRO:
IPR005116
INTERPRO:
IPR004606
INTERPRO:
IPR000847
MODBASE:
P0A9G8
PDB:
1B9M
PDB:
1H9S
PDB:
1O7L
PDB:
1H9R
PDB:
1B9N
PFAM:
PF00126
PFAM:
PF03459
PRIDE:
P0A9G8
PRODB:
PRO_000023270
PROSITE:
PS51866
REFSEQ:
NP_415282
SMR:
P0A9G8
UNIPROT:
P0A9G8


Operon      
Name: modEF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB