RegulonDB RegulonDB 10.9: Gene Form
   

acrZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

modE modA acrZ ModE CRP SoxS Rob MarA terminator anti-anti-terminator anti-terminator anti-terminator terminator modAp modAp modAp1 modAp1 acrZp acrZp

Gene      
Name: acrZ    Texpresso search in the literature
Synonym(s): ECK0751, G6396, b0762, ybhT
Genome position(nucleotides): 794773 --> 794922 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.33
External database links:  
ASAP:
ABE-0002595
ECHOBASE:
EB4074
ECOLIHUB:
ybhT
OU-MICROARRAY:
b0762
STRING:
511145.b0762
COLOMBOS: acrZ


Product      
Name: multidrug efflux pump accessory protein AcrZ
Synonym(s): AcrZ, YbhT, small membrane protein that interacts with the AcrAB-TolC multidrug efflux pump
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,outer membrane,inner membrane
Molecular weight: 5.3
Isoelectric point: 7.541
Motif(s):
 
Type Positions Sequence
1 -> 45 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQP

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0046677 - response to antibiotic
GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Hobbs EC., et al., 2010
[2] Hobbs EC., et al., 2012
External database links:  
DIP:
DIP-11423N
ECOCYC:
G6396-MONOMER
ECOLIWIKI:
b0762
INTERPRO:
IPR019702
PDB:
5O66
PDB:
6SGR
PDB:
5NC5
PDB:
5NG5
PDB:
4C48
PFAM:
PF10766
PRIDE:
P0AAW9
REFSEQ:
NP_415283
SMR:
P0AAW9
UNIPROT:
P0AAW9


Operon      
Name: acrZ         
Operon arrangement:
Transcription unit        Promoter
acrZ


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, Rob, SoxS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hobbs EC., Astarita JL., Storz G., 2010, Small RNAs and small proteins involved in resistance to cell envelope stress and acid shock in Escherichia coli: analysis of a bar-coded mutant collection., J Bacteriol 192(1):59-67

 [2] Hobbs EC., Yin X., Paul BJ., Astarita JL., Storz G., 2012, Conserved small protein associates with the multidrug efflux pump AcrB and differentially affects antibiotic resistance., Proc Natl Acad Sci U S A 109(41):16696-701


RegulonDB