RegulonDB RegulonDB 10.9: Gene Form
   

ybhH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhI ybhH ybhD anti-anti-terminator anti-terminator terminator ybhDp2 ybhDp2 ybhHp7 ybhHp7 ybhDp5 ybhDp5 ybhHp8 ybhHp8

Gene      
Name: ybhH    Texpresso search in the literature
Synonym(s): ECK0758, G6399, b0769
Genome position(nucleotides): 800759 --> 801811 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.81
External database links:  
ASAP:
ABE-0002618
ECHOBASE:
EB3428
ECOLIHUB:
ybhH
OU-MICROARRAY:
b0769
STRING:
511145.b0769
COLOMBOS: ybhH


Product      
Name: putative isomerase YbhH
Synonym(s): YbhH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 37.059
Isoelectric point: 5.664
Motif(s):
 
Type Positions Sequence
1 -> 350 MKKIPCVMMRGGTSRGAFLLAEHLPEDQTQRDKILMAIMGSGNDLEIDGIGGGNPLTSKVAIISRSSDPRADVDYLFAQVIVHEQRVDTTPNCGNMLSGVGAFAIENGLIAATSPVTRVRIRNVNTGTFIEADVQTPNGVVEYEGSARIDGVPGTAAPVALTFLNAAGTKTGKVFPTDNQIDYFDDVPVTCIDMAMPVVIIPAEYLGKTGYELPAELDADKALLARIESIRLQAGKAMGLGDVSNMVIPKPVLISPAQKGGAINVRYFMPHSCHRALAITGAIAISSSCALEGTVTRQIVPSVGYGNINIEHPSGALDVHLSNEGQDATTLRASVIRTTRKIFSGEVYLP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016853 - isomerase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Murata M., et al., 2011
External database links:  
ECOCYC:
G6399-MONOMER
ECOLIWIKI:
b0769
INTERPRO:
IPR007400
PANTHER:
PTHR43709
PDB:
6OTV
PFAM:
PF04303
PRIDE:
P0AAV8
REFSEQ:
NP_415290
SMR:
P0AAV8
UNIPROT:
P0AAV8


Operon      
Name: ybhH         
Operon arrangement:
Transcription unit        Promoter
ybhH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybhHp8 800552 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybhDp5 800620 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybhHp7 800694 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybhDp2 800709 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Murata M., Fujimoto H., Nishimura K., Charoensuk K., Nagamitsu H., Raina S., Kosaka T., Oshima T., Ogasawara N., Yamada M., 2011, Molecular strategy for survival at a critical high temperature in Eschierichia coli., PLoS One 6(6):e20063

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB