RegulonDB RegulonDB 10.8: Gene Form
   

ybhI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhJ ybhI ybhH anti-anti-terminator anti-terminator terminator terminator

Gene      
Name: ybhI    Texpresso search in the literature
Synonym(s): ECK0759, G6400, b0770
Genome position(nucleotides): 801887 --> 803320 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.79
External database links:  
ASAP:
ABE-0002621
ECHOBASE:
EB3429
OU-MICROARRAY:
b0770
PortEco:
ybhI
STRING:
511145.b0770
COLOMBOS: ybhI


Product      
Name: putative tricarboxylate transporter
Synonym(s): YbhI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.351
Isoelectric point: 9.882
Motif(s):
 
Type Positions Sequence
149 -> 169 AGGIVLPIINSVAVALGSEPE
88 -> 108 GTTWLVFSAFTLSAAFVTTGL
4 -> 474 KSLWKLILILAIPCIIGFMPAPAGLSELAWVLFGIYLAAIVGLVIKPFPEPVVLLIAVAASMVVVGNLSDGAFKTTAVLSGYSSGTTWLVFSAFTLSAAFVTTGLGKRIAYLLIGKIGNTTLGLGYVTVFLDLVLAPATPSNTARAGGIVLPIINSVAVALGSEPEKSPRRVGHYLMMSIYMVTKTTSYMFFTAMAGNILALKMINDILHLQISWGGWALAAGLPGIIMLLVTPLVIYTMYPPEIKKVDNKTIAKAGLAELGPMKIREKMLLGVFVLALLGWIFSKSLGVDESTVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWYGGIIGLSSLLSKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSIIVRYFFASGSAYIVAMLPVFAMLANVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVGAVLTILTFLVHITLGVWWWNMLIGW
28 -> 48 LSELAWVLFGIYLAAIVGLVI
298 -> 318 VAIVVMATMLLLGIVTWEDVV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Sabina J., et al., 2003
External database links:  
ECOCYC:
B0770-MONOMER
ECOLIWIKI:
b0770
INTERPRO:
IPR001898
INTERPRO:
IPR030676
PANTHER:
PTHR42826
PFAM:
PF00939
PRIDE:
P75763
REFSEQ:
NP_415291
UNIPROT:
P75763


Operon      
Name: ybhI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Sabina J., Dover N., Templeton LJ., Smulski DR., Soll D., LaRossa RA., 2003, Interfering with different steps of protein synthesis explored by transcriptional profiling of Escherichia coli K-12., J Bacteriol 185(20):6158-70


RegulonDB