RegulonDB RegulonDB 10.9: Gene Form
   

ybhI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhJ ybhI ybhH anti-anti-terminator anti-terminator terminator terminator

Gene      
Name: ybhI    Texpresso search in the literature
Synonym(s): ECK0759, G6400, b0770
Genome position(nucleotides): 801887 --> 803320 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.79
External database links:  
ASAP:
ABE-0002621
ECHOBASE:
EB3429
ECOLIHUB:
ybhI
OU-MICROARRAY:
b0770
STRING:
511145.b0770
COLOMBOS: ybhI


Product      
Name: putative tricarboxylate transporter
Synonym(s): YbhI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.351
Isoelectric point: 9.882
Motif(s):
 
Type Positions Sequence
149 -> 169 AGGIVLPIINSVAVALGSEPE
88 -> 108 GTTWLVFSAFTLSAAFVTTGL
4 -> 474 KSLWKLILILAIPCIIGFMPAPAGLSELAWVLFGIYLAAIVGLVIKPFPEPVVLLIAVAASMVVVGNLSDGAFKTTAVLSGYSSGTTWLVFSAFTLSAAFVTTGLGKRIAYLLIGKIGNTTLGLGYVTVFLDLVLAPATPSNTARAGGIVLPIINSVAVALGSEPEKSPRRVGHYLMMSIYMVTKTTSYMFFTAMAGNILALKMINDILHLQISWGGWALAAGLPGIIMLLVTPLVIYTMYPPEIKKVDNKTIAKAGLAELGPMKIREKMLLGVFVLALLGWIFSKSLGVDESTVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWYGGIIGLSSLLSKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSIIVRYFFASGSAYIVAMLPVFAMLANVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVGAVLTILTFLVHITLGVWWWNMLIGW
28 -> 48 LSELAWVLFGIYLAAIVGLVI
298 -> 318 VAIVVMATMLLLGIVTWEDVV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Sabina J., et al., 2003
External database links:  
ECOCYC:
B0770-MONOMER
ECOLIWIKI:
b0770
INTERPRO:
IPR030676
INTERPRO:
IPR001898
PANTHER:
PTHR42826
PFAM:
PF00939
PRIDE:
P75763
REFSEQ:
NP_415291
UNIPROT:
P75763


Operon      
Name: ybhI         
Operon arrangement:
Transcription unit        Promoter
ybhI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Sabina J., Dover N., Templeton LJ., Smulski DR., Soll D., LaRossa RA., 2003, Interfering with different steps of protein synthesis explored by transcriptional profiling of Escherichia coli K-12., J Bacteriol 185(20):6158-70


RegulonDB