RegulonDB RegulonDB 10.9: Gene Form
   

ybhQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhS ybhR ybhP ybhQ ybhF clsB ybhQp ybhQp

Gene      
Name: ybhQ    Texpresso search in the literature
Synonym(s): ECK0780, G6408, b0791
Genome position(nucleotides): 824630 --> 825040 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.5
External database links:  
ASAP:
ABE-0002699
ECHOBASE:
EB3437
ECOLIHUB:
ybhQ
OU-MICROARRAY:
b0791
STRING:
511145.b0791
COLOMBOS: ybhQ


Product      
Name: putative inner membrane protein
Synonym(s): YbhQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.465
Isoelectric point: 10.613
Motif(s):
 
Type Positions Sequence
13 -> 33 LSCWQIMLHLLVVALLVVGWM
72 -> 92 VLEELTTTWYFGAALIVLWLL
1 -> 132 MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLCALYCVTVVMMLVFQRHPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAIAGLAILAGPAVVSLLAKDKKLHHLTSKH
38 -> 58 VHVGVGLCALYCVTVVMMLVF
100 -> 120 FLLAIAGLAILAGPAVVSLLA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6408-MONOMER
ECOLIWIKI:
b0791
INTERPRO:
IPR021303
PFAM:
PF11076
PRIDE:
P0AAW5
REFSEQ:
NP_415312
UNIPROT:
P0AAW5


Operon      
Name: ybhQ         
Operon arrangement:
Transcription unit        Promoter
ybhQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB