RegulonDB RegulonDB 10.9: Gene Form
   

mcbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: mcbA    Texpresso search in the literature
Synonym(s): ECK0795, G6415, b0806, ybiM
Genome position(nucleotides): 841796 <-- 842056 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.49
External database links:  
ASAP:
ABE-0002753
ECHOBASE:
EB3102
ECOLIHUB:
mcbA
OU-MICROARRAY:
b0806
STRING:
511145.b0806
COLOMBOS: mcbA


Product      
Name: DUF1471 domain-containing protein McbA
Synonym(s): McbA, YbiM, protein involved in colanic acid production
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 8.896
Isoelectric point: 8.463
Motif(s):
 
Type Positions Sequence
1 -> 22 MKKCLTLLIATVLSGISLTAYA
23 -> 86 AQPMSNLDSGQLRPAGTVSATGASNLSDLEDKLAEKAREQGAKGYVINSAGGNDQMFGTATIYK
34 -> 86 LRPAGTVSATGASNLSDLEDKLAEKAREQGAKGYVINSAGGNDQMFGTATIYK

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
GO:0031236 - extrinsic component of periplasmic side of plasma membrane
biological_process GO:0009242 - colanic acid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Zhang XS., et al., 2008
External database links:  
ECOCYC:
G6415-MONOMER
ECOLIWIKI:
b0806
INTERPRO:
IPR010854
INTERPRO:
IPR025543
INTERPRO:
IPR036275
PFAM:
PF07338
PRIDE:
P0AAX6
REFSEQ:
NP_415327
SMR:
P0AAX6
UNIPROT:
P0AAX6


Operon      
Name: mcbA         
Operon arrangement:
Transcription unit        Promoter
mcbA


Transcriptional Regulation      
Display Regulation             
Repressed by: McbR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiXp2 839274 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rlmFp1 842192 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rlmFp7 842224 forward Similarity to the consensus
Read more >
[ICWHO] [2]



RegulonDB