RegulonDB RegulonDB 10.9: Gene Form
   

mntR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiR ldtB mntR rybA mntS yliL MntR MntR TSS_980 TSS_980 TSS_979 TSS_979 mntRp4 mntRp4 mntRp mntRp mntRp5 mntRp5 mntRp6 mntRp6 rybAp rybAp TSS_978 TSS_978

Gene      
Name: mntR    Texpresso search in the literature
Synonym(s): ECK0807, G6420, b0817, ybiQ
Genome position(nucleotides): 853183 --> 853650 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.06
External database links:  
ASAP:
ABE-0002793
ECHOBASE:
EB3106
ECOLIHUB:
mntR
OU-MICROARRAY:
b0817
STRING:
511145.b0817
COLOMBOS: mntR


Product      
Name: DNA-binding transcriptional dual regulator MntR
Synonym(s): MntR, YbiQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.64
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
38 -> 92 IDDYVELISDLIREVGEARQVDMAARLGVSQPTVAKMLKRLATMGLIEMIPWRGV
95 -> 149 TAEGEKLAQESRERHQIVENFLLVLGVSPEIARRDAEGMEHHVSEETLDAFRLFT
34 -> 95 RRELIDDYVELISDLIREVGEARQVDMAARLGVSQPTVAKMLKRLATMGLIEMIPWRGVFLT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046914 - transition metal ion binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0030145 - manganese ion binding
GO:0046983 - protein dimerization activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:2000144 - positive regulation of DNA-templated transcription, initiation
External database links:  
DIP:
DIP-28083N
ECOCYC:
G6420-MONOMER
ECOLIWIKI:
b0817
INTERPRO:
IPR022689
INTERPRO:
IPR036421
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR022687
INTERPRO:
IPR001367
MODBASE:
P0A9F1
PDB:
2H09
PFAM:
PF01325
PFAM:
PF02742
PRIDE:
P0A9F1
PRODB:
PRO_000023259
PROSITE:
PS50944
REFSEQ:
NP_415338
SMART:
SM00529
SMR:
P0A9F1
UNIPROT:
P0A9F1


Operon      
Name: mntR-ybiR         
Operon arrangement:
Transcription unit        Promoter
mntR-ybiR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_978 853047 reverse nd [RS-EPT-CBR] [1]
  promoter mntRp6 853080 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter mntRp5 853083 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter mntRp4 853135 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_979 853137 forward nd [RS-EPT-CBR] [1]
  promoter TSS_980 855304 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB