RegulonDB RegulonDB 10.8: Gene Form
   

ybiT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ybiT    Texpresso search in the literature
Synonym(s): ECK0810, G6423, b0820
Genome position(nucleotides): 855963 --> 857555 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.79
External database links:  
ASAP:
ABE-0002801
ECHOBASE:
EB3109
OU-MICROARRAY:
b0820
PortEco:
ybiT
STRING:
511145.b0820
COLOMBOS: ybiT


Product      
Name: putative ATP-binding protein YbiT
Synonym(s): YbiT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.858
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
336 -> 467 KNLNLLLEVGEKLAVLGTNGVGKSTLLKTLVGDLQPDSGTVKWSENARIGYYAQDHEYEFENDLTVFEWMSQWKQEGDDEQAVRSILGRLLFSQDDIKKPAKVLSGGEKGRMLFGKLMMQKPNILIMDEPTN
34 -> 41 GANGSGKS
224 -> 309 DLDYGELRVYPGNYDEYMTAATQARERLLADNAKKKAQIAELQSFVSRFSANASKSRQATSRARQIDKIKLEEVKASSRQNPFIRF
352 -> 359 GTNGVGKS
2 -> 252 LVSSNVTMQFGSKPLFENISVKFGGGNRYGLIGANGSGKSTFMKILGGDLEPTLGNVSLDPNERIGKLRQDQFAFEEFTVLDTVIMGHKELWEVKQERDRIYALPEMSEEDGYKVADLEVKYGEMDGYSAEARAGELLLGVGIPVEQHYGPMSEVAPGWKLRVLLAQALFADPDILLLDEPTNNLDIDTIRWLEQVLNERDSTMIIISHDRHFLNMVCTHMADLDYGELRVYPGNYDEYMTAATQARERLL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
Reference(s): [1] Llama-Palacios A., et al., 2002
[2] Phadtare S., et al., 2004
[3] Xu Y., et al., 2017
External database links:  
DIP:
DIP-11439N
ECOCYC:
G6423-MONOMER
ECOLIWIKI:
b0820
INTERPRO:
IPR003593
INTERPRO:
IPR032781
INTERPRO:
IPR027417
INTERPRO:
IPR003439
MINT:
MINT-1321005
MODBASE:
P0A9U3
PFAM:
PF00005
PFAM:
PF12848
PRIDE:
P0A9U3
PROSITE:
PS50893
REFSEQ:
NP_415341
SMART:
SM00382
SMR:
P0A9U3
UNIPROT:
P0A9U3


Operon      
Name: ybiT         
Operon arrangement:
Transcription unit        Promoter
ybiT


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_980 855304 reverse nd [RS-EPT-CBR] [4]



RegulonDB