RegulonDB RegulonDB 11.0: Gene Form
   

gsiC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gsiB gsiC gsiD

Gene      
Name: gsiC    Texpresso search in the literature
Synonym(s): ECK0821, G6431, b0831, yliC
Genome position(nucleotides): 870967 --> 871887
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.53
External database links:  
ASAP:
ABE-0002834
ECHOBASE:
EB3247
ECOLIHUB:
gsiC
OU-MICROARRAY:
b0831
STRING:
511145.b0831
COLOMBOS: gsiC


Product      
Name: glutathione ABC transporter membrane subunit GsiC
Synonym(s): GsiC, YliC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.066
Isoelectric point: 7.863
Motif(s):
 
Type Positions Sequence Comment
1 -> 76 MLNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISNAVQGD
9 -> 29 LLGLIPTLFIVSVLVFLFVHM UniProt: Helical.
95 -> 292 FMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVELGWLPTVGADSWQHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVV UniProt: ABC transmembrane type-1.
103 -> 123 ITSMVWAVIFGMAAGIIAAVW UniProt: Helical.
113 -> 304 GMAAGIIAAVWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVELGWLPTVGADSWQHYILPSLTLGAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFGFLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVVDVLYAAINPAIR

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0034634 - glutathione transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0034775 - glutathione transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P75798
ECOCYC:
YLIC-MONOMER
ECOLIWIKI:
b0831
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PFAM:
PF19300
PRIDE:
P75798
PRODB:
PRO_000022846
PROSITE:
PS50928
REFSEQ:
NP_415352
SMR:
P75798
UNIPROT:
P75798


Operon      
Name: iaaA-gsiABCD         
Operon arrangement:
Transcription unit        Promoter
iaaA-gsiABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB