RegulonDB RegulonDB 10.9: Gene Form
   

macB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

macB macA ybjX cspD ybjD MqsA TSS_1028 (cluster) TSS_1028 (cluster) TSS_1027 TSS_1027 TSS_1026 TSS_1026 macBp2 macBp2 macBp1 macBp1 ybjXp ybjXp

Gene      
Name: macB    Texpresso search in the literature
Synonym(s): ECK0870, G6462, b0879, ybjZ
Genome position(nucleotides): 920347 --> 922293 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.93
External database links:  
ASAP:
ABE-0002989
ECHOBASE:
EB3459
ECOLIHUB:
macB
OU-MICROARRAY:
b0879
STRING:
511145.b0879
COLOMBOS: macB


Product      
Name: ABC-type tripartite efflux pump ATP binding/membrane subunit
Synonym(s): MacB, YbjZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 70.702
Isoelectric point: 6.275
Motif(s):
 
Type Positions Sequence
47 -> 47 K
611 -> 631 PLALLLAFLCSTVTGILFGWL
145 -> 148 LSGG
272 -> 491 TLLTMLGIIIGIASVVSIVVVGDAAKQMVLADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRYNNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVVGEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGFDSAEAEQQLTR
349 -> 349 T

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.am - ABC superfamily, ATP binding and membrane component
Gene Ontology Terms (GO)  
cellular_component GO:1990196 - MacAB-TolC complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0042897 - polymyxin transmembrane transporter activity
GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015562 - efflux transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0008559 - ATPase-coupled xenobiotic transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0042893 - polymyxin transport
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
Reference(s): [1] Alon Cudkowicz N., et al., 2019
[2] Jo I., et al., 2017
[3] Nishino K., et al., 2001
[4] Pu Y., et al., 2016
[5] Shuster Y., et al., 2016
External database links:  
ECOCYC:
MACB
ECOLIWIKI:
b0879
INTERPRO:
IPR003838
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017911
INTERPRO:
IPR027417
INTERPRO:
IPR025857
INTERPRO:
IPR017871
MODBASE:
P75831
PDB:
5NIL
PDB:
5NIK
PDB:
5LJA
PDB:
5LJ9
PDB:
5LJ8
PFAM:
PF00005
PFAM:
PF12704
PFAM:
PF02687
PRIDE:
P75831
PRODB:
PRO_000023145
PROSITE:
PS50893
PROSITE:
PS00211
PROSITE:
PS51267
REFSEQ:
NP_415400
SMART:
SM00382
SMR:
P75831
SWISSMODEL:
P75831
UNIPROT:
P75831


Operon      
Name: macAB         
Operon arrangement:
Transcription unit        Promoter
macAB
macB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter macBp1 920094 forward The sigma factor was determined
Read more >
[AIPP], [ICWHO] [6], [7]
  promoter macBp2 920337 forward The sigma factor was determined
Read more >
[AIPP], [ICWHO] [6], [7]
  promoter TSS_1026 921483 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1027 921911 forward nd [RS-EPT-CBR] [8]
  promoter TSS_1028 (cluster) 922360 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]


Evidence    

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Alon Cudkowicz N., Schuldiner S., 2019, Deletion of the major Escherichia coli multidrug transporter AcrB reveals transporter plasticity and redundancy in bacterial cells., PLoS One 14(6):e0218828

 [2] Jo I., Hong S., Lee M., Song S., Kim JS., Mitra AK., Hyun J., Lee K., Ha NC., 2017, Stoichiometry and mechanistic implications of the MacAB-TolC tripartite efflux pump., Biochem Biophys Res Commun 494(3-4):668-673

 [3] Nishino K., Yamaguchi A., 2001, Analysis of a complete library of putative drug transporter genes in Escherichia coli., J Bacteriol 183(20):5803-12

 [4] Pu Y., Zhao Z., Li Y., Zou J., Ma Q., Zhao Y., Ke Y., Zhu Y., Chen H., Baker MAB., Ge H., Sun Y., Xie XS., Bai F., 2016, Enhanced Efflux Activity Facilitates Drug Tolerance in Dormant Bacterial Cells., Mol Cell 62(2):284-294

 [5] Shuster Y., Steiner-Mordoch S., Alon Cudkowicz N., Schuldiner S., 2016, A Transporter Interactome Is Essential for the Acquisition of Antimicrobial Resistance to Antibiotics., PLoS One 11(4):e0152917

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [7] Zhao K., Liu M., Burgess RR., 2005, The global transcriptional response of Escherichia coli to induced sigma 32 protein involves sigma 32 regulon activation followed by inactivation and degradation of sigma 32 in vivo., J Biol Chem 280(18):17758-68

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB