RegulonDB RegulonDB 10.9: Gene Form
   

ycaQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaQ lpxK ycaR msbA kdsB TSS_1191 (cluster) TSS_1191 (cluster) ycaRp ycaRp TSS_1190 TSS_1190

Gene      
Name: ycaQ    Texpresso search in the literature
Synonym(s): ECK0907, G6471, alkZ, b0916
Genome position(nucleotides): 969389 --> 970621 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.31
External database links:  
ASAP:
ABE-0003117
ECHOBASE:
EB3465
ECOLIHUB:
ycaQ
OU-MICROARRAY:
b0916
STRING:
511145.b0916
COLOMBOS: ycaQ


Product      
Name: interstrand DNA crosslink repair glycosylase
Synonym(s): AlkZ, YcaQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.656
Isoelectric point: 8.682
Motif(s):
 
Type Positions Sequence
45 -> 45 Q
47 -> 47 D
38 -> 381 ISRMSLLQIDTINIVARSPYLVLFSRLGNYPAQWLDESLARGELMEYWAHEACFMPRSDFRLIRHRMLAPEKMGWKYKDAWMQEHEAEIAQLIQHIHDKGPVRSADFEHPRKGASGWWEWKPHKRHLEGLFTAGKVMVIERRNFQRVYDLTHRVMPDWDDERDLVSQTEAEIIMLDNSARSLGIFREQWLADYYRLKRPALAAWREARAEQQQIIAVHVEKLGNLWLHDDLLPLLERALAGKLTATHSAVLSPFDPVVWDRKRAEQLFDFSYRLECYTPAPKRQYGYFVLPLLHRGQLVGRMDAKMHRQTGILEVISLWLQEGIKPTTTLQKGLRQAITDFANW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0019104 - DNA N-glycosylase activity
biological_process GO:0036297 - interstrand cross-link repair
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6471-MONOMER
ECOLIWIKI:
b0916
INTERPRO:
IPR009351
PFAM:
PF06224
PRIDE:
P75843
REFSEQ:
NP_415436
SMR:
P75843
UNIPROT:
P75843


Operon      
Name: ycaI-msbA-lpxK-ycaQ         
Operon arrangement:
Transcription unit        Promoter
ycaI-msbA-lpxK-ycaQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1190 970640 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1191 (cluster) 970643 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB