RegulonDB RegulonDB 10.9: Gene Form
   

mepK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ldtD gloC mepK TSS_1206 TSS_1206 TSS_1205 TSS_1205 TSS_1204 TSS_1204 TSS_1203 (cluster) TSS_1203 (cluster) TSS_1202 TSS_1202 TSS_1201 TSS_1201 TSS_1200 TSS_1200 mepKp mepKp TSS_1198 TSS_1198

Gene      
Name: mepK    Texpresso search in the literature
Synonym(s): ECK0917, G6474, b0926, ycbK
Genome position(nucleotides): 983075 --> 983623 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.73
External database links:  
ASAP:
ABE-0003145
ECHOBASE:
EB3467
ECOLIHUB:
ycbK
OU-MICROARRAY:
b0926
STRING:
511145.b0926
COLOMBOS: mepK


Product      
Name: peptidoglycan LD-endopeptidase
Synonym(s): MepK, YcbK
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 20.354
Isoelectric point: 10.833
Motif(s):
 
Type Positions Sequence
1 -> 30 MDKFDANRRKLLALGGVALGAAILPTPAFA
133 -> 133 H
140 -> 140 D
31 -> 182 TLSTPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW
34 -> 182 TPRPRILTLNNLHTGESIKAEFFDGRGYIQEELAKLNHFFRDYRANKIKSIDPGLFDQLYRLQGLLGTRKPVQLISGYRSIDTNNELRARSRGVAKKSYHTKGQAMDFHIEGIALSNIRKAALSMRAGGVGYYPRSNFVHIDTGPARHW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0004175 - endopeptidase activity
GO:0004222 - metalloendopeptidase activity
biological_process GO:0006508 - proteolysis
GO:0009254 - peptidoglycan turnover
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6474-MONOMER
ECOLIWIKI:
b0926
INTERPRO:
IPR006311
INTERPRO:
IPR009045
INTERPRO:
IPR010275
PANTHER:
PTHR37425
PFAM:
PF05951
PRIDE:
P0AB06
PROSITE:
PS51318
REFSEQ:
NP_415446
SMR:
P0AB06
UNIPROT:
P0AB06


Operon      
Name: mepK-gloC         
Operon arrangement:
Transcription unit        Promoter
mepK-gloC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1198 983021 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1200 983050 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1201 983052 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1202 983510 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1203 (cluster) 983574 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1204 983579 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1205 983585 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1206 983935 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB