RegulonDB RegulonDB 10.9: Gene Form
   

gloC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aspC gloC mepK TSS_1211 TSS_1211 TSS_1210 TSS_1210 TSS_1209 TSS_1209 TSS_1208 TSS_1208 TSS_1207 (cluster) TSS_1207 (cluster) TSS_1206 TSS_1206 TSS_1205 TSS_1205 TSS_1204 TSS_1204 TSS_1203 (cluster) TSS_1203 (cluster) TSS_1202 TSS_1202

Gene      
Name: gloC    Texpresso search in the literature
Synonym(s): ECK0918, G6475, b0927, ycbL
Genome position(nucleotides): 983650 --> 984297 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.54
External database links:  
ASAP:
ABE-0003147
ECHOBASE:
EB3468
ECOLIHUB:
ycbL
OU-MICROARRAY:
b0927
STRING:
511145.b0927
COLOMBOS: gloC


Product      
Name: hydroxyacylglutathione hydrolase GloC
Synonym(s): GloC, GlxII-2, YcbL, glyoxalase II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.784
Isoelectric point: 4.774
Motif(s):
 
Type Positions Sequence
10 -> 192 AFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLDHVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEECQPLTPDRWLNEGDTISIGNVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKLLPLGDDVIFIPGH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.23 - methylglyoxal metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004416 - hydroxyacylglutathione hydrolase activity
biological_process GO:0019243 - methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione
GO:0009636 - response to toxic substance
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-11480N
ECOCYC:
G6475-MONOMER
ECOLIWIKI:
b0927
INTERPRO:
IPR001279
INTERPRO:
IPR036866
MODBASE:
P75849
PFAM:
PF00753
PRIDE:
P75849
REFSEQ:
NP_415447
SMART:
SM00849
SMR:
P75849
UNIPROT:
P75849


Operon      
Name: mepK-gloC         
Operon arrangement:
Transcription unit        Promoter
mepK-gloC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1202 983510 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1203 (cluster) 983574 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1204 983579 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1205 983585 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1206 983935 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1207 (cluster) 984970 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1208 985039 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1209 985236 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1210 985360 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1211 985652 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB