RegulonDB RegulonDB 11.0: Gene Form
   

ssuA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ssuD ssuA ssuC ssuE elfA ssuB IHF IHF Cbl CysB IHF anti-terminator anti-anti-terminator elfDp1 elfDp1 elfAp8 elfAp8 elfAp7 elfAp7 elfAp6 elfAp6 ssuEp ssuEp ssuBp3 ssuBp3

Gene      
Name: ssuA    Texpresso search in the literature
Synonym(s): ECK0927, G6478, b0936, ycbO
Genome position(nucleotides): 995985 <-- 996944
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.4
External database links:  
ASAP:
ABE-0003180
ECHOBASE:
EB3471
ECOLIHUB:
ssuA
OU-MICROARRAY:
b0936
STRING:
511145.b0936
COLOMBOS: ssuA


Product      
Name: aliphatic sulfonate ABC transporter periplasmic binding protein
Synonym(s): SsuA, YcbO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 34.558
Isoelectric point: 9.531
Motif(s):
 
Type Positions Sequence Comment
1 -> 21 MRNIIKLALAGLLSVSTFAVA
22 -> 319 AESSPEALRIGYQKGSIGMVLAKSHQLLEKRYPESKISWVEFPAGPQMLEALNVGSIDLGSTGDIPPIFAQAAGADLVYVGVEPPKPKAEVILVAENSPIKTVADLKGHKVAFQKGSSSHNLLLRALRQAGLKFTDIQPTYLTPADARAAFQQGNVDAWAIWDPYYSAALLQGGVRVLKDGTDLNQTGSFYLAARPYAEKNGAFIQGVLATFSEADALTRSQREQSIALLAKTMGLPAPVIASYLDHRPPTTIKPVNAEVAALQQQTADLFYENRLVPKKVDIRQRIWQPTQLEGKQL UniProt: Putative aliphatic sulfonates-binding protein.
68 -> 182 QMLEALNVGSIDLGSTGDIPPIFAQAAGADLVYVGVEPPKPKAEVILVAENSPIKTVADLKGHKVAFQKGSSSHNLLLRALRQAGLKFTDIQPTYLTPADARAAFQQGNVDAWAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0042959 - alkanesulfonate transmembrane transporter activity
biological_process GO:0006790 - sulfur compound metabolic process
GO:0055085 - transmembrane transport
GO:0042918 - alkanesulfonate transport
GO:0010438 - cellular response to sulfur starvation
Note(s): Note(s): ...[more].
Reference(s): [1] Wan Y., et al., 2021
External database links:  
ALPHAFOLD:
P75853
ECOCYC:
G6478-MONOMER
ECOLIWIKI:
b0936
INTERPRO:
IPR001638
INTERPRO:
IPR015168
INTERPRO:
IPR010067
MODBASE:
P75853
PDB:
2X26
PFAM:
PF09084
PRIDE:
P75853
REFSEQ:
NP_415456
SMART:
SM00062
SMR:
P75853
UNIPROT:
P75853


Operon      
Name: ssuEADCB         
Operon arrangement:
Transcription unit        Promoter
ssuEADCB


Transcriptional Regulation      
Display Regulation             
Activated by: Cbl, FNR, IHF
Repressed by: CysB, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ssuBp3 994141 reverse nd [ICWHO] [2]
  promoter elfAp6 997765 forward nd [ICWHO] [2]
  promoter elfAp7 997808 forward nd [ICWHO] [2]
  promoter elfAp8 997814 forward nd [ICWHO] [2]
  promoter elfDp1 998321 forward nd [ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Wan Y., Wang M., Chan EWC., Chen S., 2021, Membrane Transporters of the Major Facilitator Superfamily Are Essential for Long-Term Maintenance of Phenotypic Tolerance to Multiple Antibiotics in E. coli., Microbiol Spectr 9(3):e0184621

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB