RegulonDB RegulonDB 11.0: Gene Form
   

elfD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

elfC elfD elfA elfG terminator anti-terminator anti-anti-terminator elfDp1 elfDp1

Gene      
Name: elfD    Texpresso search in the literature
Synonym(s): ECK0930, G6481, b0939, ycbR
Genome position(nucleotides): 998490 --> 999191
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.01
External database links:  
ASAP:
ABE-0003187
ECHOBASE:
EB3474
ECOLIHUB:
ycbR
OU-MICROARRAY:
b0939
STRING:
511145.b0939
COLOMBOS: elfD


Product      
Name: putative fimbrial chaperone ElfD
Synonym(s): ElfD, YcbR
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 25.389
Isoelectric point: 10.087
Motif(s):
 
Type Positions Sequence Comment
1 -> 26 MKTCITKGIVTVSLTAILLSCSSAWA
27 -> 233 AGKGGIGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKRKEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITLTDLKIGGKVVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS UniProt: Probable fimbrial chaperone protein ElfD.
31 -> 148 GIGLAATRLVYSEGEEQISLGVRNTSPDVPYLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVPSTTKRKEGNTLKIATQSVIKLFWRPKGL
170 -> 226 VSNPTPYFITLTDLKIGGKVVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAET

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006457 - protein folding
GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] DeLisa MP., et al., 2001
[2] Korea CG., et al., 2010
[3] Korea CG., et al., 2011
[4] Wurpel DJ., et al., 2013
[5] Zhai Y., et al., 2002
External database links:  
ALPHAFOLD:
P75856
ECOCYC:
G6481-MONOMER
ECOLIWIKI:
b0939
INTERPRO:
IPR008962
INTERPRO:
IPR018046
INTERPRO:
IPR016147
INTERPRO:
IPR016148
INTERPRO:
IPR013783
INTERPRO:
IPR001829
INTERPRO:
IPR036316
MODBASE:
P75856
PFAM:
PF02753
PFAM:
PF00345
PRIDE:
P75856
PRINTS:
PR00969
PROSITE:
PS00635
REFSEQ:
NP_415459
SMR:
P75856
SWISSMODEL:
P75856
UNIPROT:
P75856


Operon      
Name: elfDCG-ycbUVF         
Operon arrangement:
Transcription unit        Promoter
elfDCG-ycbUVF


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter elfDp1 998321 forward nd [ICWHO] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] DeLisa MP., Wu CF., Wang L., Valdes JJ., Bentley WE., 2001, DNA microarray-based identification of genes controlled by autoinducer 2-stimulated quorum sensing in Escherichia coli., J Bacteriol 183(18):5239-47

 [2] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [3] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [5] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB