RegulonDB RegulonDB 10.9: Gene Form
   

sxy gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccS sxy sulA yccF CRP-Sxy LexA RcdA RcdA yccSp2 yccSp2 yccSp3 yccSp3 TSS_1285 TSS_1285 sxyp sxyp TSS_1283 TSS_1283 sulAp sulAp

Gene      
Name: sxy    Texpresso search in the literature
Synonym(s): ECK0950, G6494, b0959, yccR
Genome position(nucleotides): 1021138 --> 1021767 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.1
External database links:  
ASAP:
ABE-0003249
ECHOBASE:
EB3484
ECOLIHUB:
sxy
OU-MICROARRAY:
b0959
STRING:
511145.b0959
COLOMBOS: sxy


Product      
Name: transcriptional coactivator for CRP
Synonym(s): Sxy, YccR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.147
Isoelectric point: 9.253
Motif(s):
 
Type Positions Sequence
116 -> 194 RERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAIIGIHEAALPVARRQELAEW
14 -> 106 EYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKLVRLSKYSLDAA

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0051090 - regulation of DNA-binding transcription factor activity
GO:0030420 - establishment of competence for transformation
GO:0051091 - positive regulation of DNA-binding transcription factor activity
GO:0009290 - DNA import into cell involved in transformation
GO:1903658 - positive regulation of type IV pilus biogenesis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Cameron AD., et al., 2006
[2] Jaskolska M., et al., 2015
External database links:  
DIP:
DIP-11497N
ECOCYC:
G6494-MONOMER
ECOLIWIKI:
b0959
INTERPRO:
IPR007077
INTERPRO:
IPR007076
INTERPRO:
IPR026256
PFAM:
PF04994
PFAM:
PF04993
PRIDE:
P75869
PRODB:
PRO_000024017
REFSEQ:
NP_415479
SMR:
P75869
UNIPROT:
P75869


Operon      
Name: sxy         
Operon arrangement:
Transcription unit        Promoter
yccR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP-Sxy


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1283 1020949 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1285 1021378 forward nd [RS-EPT-CBR] [3]
  promoter yccSp3 1023976 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yccSp2 1023994 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Cameron AD., Redfield RJ., 2006, Non-canonical CRP sites control competence regulons in Escherichia coli and many other gamma-proteobacteria., Nucleic Acids Res 34(20):6001-14

 [2] Jaskolska M., Gerdes K., 2015, CRP-dependent positive autoregulation and proteolytic degradation regulate competence activator Sxy of Escherichia coli., Mol Microbiol 95(5):833-45

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB