RegulonDB RegulonDB 10.9: Gene Form
   

yccU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccT yccU hspQ CsgD anti-anti-terminator anti-terminator TSS_1293 TSS_1293 TSS_1292 TSS_1292 TSS_1291 (cluster) TSS_1291 (cluster) yccTp yccTp TSS_1290 TSS_1290 yccTp5 yccTp5

Gene      
Name: yccU    Texpresso search in the literature
Synonym(s): ECK0956, G6499, b0965
Genome position(nucleotides): 1027946 --> 1028359 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.35
External database links:  
ASAP:
ABE-0003267
ECHOBASE:
EB3487
ECOLIHUB:
yccU
OU-MICROARRAY:
b0965
STRING:
511145.b0965
COLOMBOS: yccU


Product      
Name: putative HspQ acetyl donor
Synonym(s): YccU, putative CoA binding protein YccU, putative CoA-binding protein with NAD(P)-binding Rossmann-fold domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.701
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
15 -> 130 TIALVGASDKPDRPSYRVMKYLLDQGYHVIPVSPKVAGKTLLGQKGYGTLADVPEKVDMVDVFRNSEAAWGVAQEAIAIGAKTLWMQLGVINEQAAVLARDAGLNVVMDRCPAIEI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
Evidence: [HIFSO] Human inference of function by sequence orthology
Reference(s): [1] Wasinger VC., et al., 1998
[2] Yeom J., et al., 2019
External database links:  
DIP:
DIP-28069N
ECOCYC:
G6499-MONOMER
ECOLIWIKI:
b0965
INTERPRO:
IPR003781
INTERPRO:
IPR036291
MODBASE:
P75874
PFAM:
PF13380
PRIDE:
P75874
REFSEQ:
NP_415485
SMART:
SM00881
SMR:
P75874
UNIPROT:
P75874


Operon      
Name: yccU         
Operon arrangement:
Transcription unit        Promoter
yccU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yccTp5 1027797 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1290 1027835 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1291 (cluster) 1027925 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1292 1027929 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1293 1028531 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Wasinger VC., Humphery-Smith I., 1998, Small genes/gene-products in Escherichia coli K-12., FEMS Microbiol Lett 169(2):375-82

 [2] Yeom J., Groisman EA., 2019, Activator of one protease transforms into inhibitor of another in response to nutritional signals., Genes Dev 33(17-18):1280-1292

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB