RegulonDB RegulonDB 10.9: Gene Form
   

cspG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cspG cspH ymcF ymcE Cis-reg; thermoregulator anti-anti-terminator anti-terminator terminator terminator ymcEp3 ymcEp3 cspHp13 cspHp13 cspHp9 cspHp9 cspHp15 cspHp15 cspGp cspGp cspHp14 cspHp14 cspHp12 cspHp12 cspHp10 cspHp10 cspHp8 cspHp8

Gene      
Name: cspG    Texpresso search in the literature
Synonym(s): ECK0980, G6511, b0990
Genome position(nucleotides): 1051461 --> 1051673 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.13
External database links:  
ASAP:
ABE-0003346
ECHOBASE:
EB3993
ECOLIHUB:
cspG
OU-MICROARRAY:
b0990
STRING:
511145.b0990
COLOMBOS: cspG


Product      
Name: cold shock protein CspG
Synonym(s): CspG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 7.781
Isoelectric point: 5.741
Motif(s):
 
Type Positions Sequence
7 -> 67 GLVKWFNADKGFGFITPDDGSKDVFVHFTAIQSNEFRTLNENQKVEFSIEQGQRGPAAANV
5 -> 69 MTGLVKWFNADKGFGFITPDDGSKDVFVHFTAIQSNEFRTLNENQKVEFSIEQGQRGPAAANVVT

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0001072 - transcription antitermination factor activity, RNA binding
biological_process GO:0031564 - transcription antitermination
GO:0009409 - response to cold
GO:0010468 - regulation of gene expression
GO:0060567 - negative regulation of DNA-templated transcription, termination
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IGI] Inferred from genetic interaction
Reference(s): [1] Higuchi K., et al., 2020
[2] Kram KE., et al., 2020
[3] Nahku R., et al., 2011
[4] Nakashima K., et al., 1996
[5] Uppal S., et al., 2015
[6] Verbenko VN., et al., 2009
[7] Xia B., et al., 2001
External database links:  
DIP:
DIP-47938N
ECOCYC:
G6511-MONOMER
ECOLIWIKI:
b0990
INTERPRO:
IPR019844
INTERPRO:
IPR012340
INTERPRO:
IPR002059
INTERPRO:
IPR011129
INTERPRO:
IPR012156
MODBASE:
P0A978
PFAM:
PF00313
PRIDE:
P0A978
PRINTS:
PR00050
PRODB:
PRO_000022343
PROSITE:
PS51857
PROSITE:
PS00352
REFSEQ:
NP_415510
SMART:
SM00357
SMR:
P0A978
SWISSMODEL:
P0A978
UNIPROT:
P0A978


Operon      
Name: cspG         
Operon arrangement:
Transcription unit        Promoter
cspG


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cspHp8 1051205 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter cspHp10 1051278 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter cspHp12 1051284 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter cspHp14 1051304 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter cspGp 1051305 forward nd [AIPP], [RS-EPT-CBR] [9], [10]
  promoter cspHp15 1051307 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter cspHp9 1051330 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter cspHp13 1051373 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter ymcEp3 1051830 forward Similarity to the consensus
Read more >
[ICWHO] [8]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Higuchi K., Yabuki T., Ito M., Kigawa T., 2020, Cold shock proteins improve E. coli cell-free synthesis in terms of soluble yields of aggregation-prone proteins., Biotechnol Bioeng 117(6):1628-1639

 [2] Kram KE., Henderson AL., Finkel SE., 2020, Escherichia coli Has a Unique Transcriptional Program in Long-Term Stationary Phase Allowing Identification of Genes Important for Survival., mSystems 5(4)

 [3] Nahku R., Peebo K., Valgepea K., Barrick JE., Adamberg K., Vilu R., 2011, Stock culture heterogeneity rather than new mutational variation complicates short-term cell physiology studies of Escherichia coli K-12 MG1655 in continuous culture., Microbiology 157(Pt 9):2604-2610

 [4] Nakashima K., Kanamaru K., Mizuno T., Horikoshi K., 1996, A novel member of the cspA family of genes that is induced by cold shock in Escherichia coli., J Bacteriol 178(10):2994-7

 [5] Uppal S., Jawali N., 2015, Cyclic AMP receptor protein (CRP) regulates the expression of cspA, cspB, cspG and cspI, members of cspA family, in Escherichia coli., Arch Microbiol 197(3):497-501

 [6] Verbenko VN., Kuznetsova LV., Luchkina LA., Klonov NV., 2009, [Mutation in the cspH-cspG gene cluster enhances expression of heat-shock proteins and SOS repair system of Escherichia coli]., Genetika 45(9):1194-202

 [7] Xia B., Ke H., Inouye M., 2001, Acquirement of cold sensitivity by quadruple deletion of the cspA family and its suppression by PNPase S1 domain in Escherichia coli., Mol Microbiol 40(1):179-88

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Wang N., Yamanaka K., Inouye M., 1999, CspI, the ninth member of the CspA family of Escherichia coli, is induced upon cold shock., J Bacteriol 181(5):1603-9


RegulonDB