RegulonDB RegulonDB 10.8: Gene Form
   

torS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: torS    Texpresso search in the literature
Synonym(s): ECK0984, G6514, b0993, yccI
Genome position(nucleotides): 1053434 <-- 1056178 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
Reference(s): [1] Jourlin C., et al., 1996
External database links:  
ASAP:
ABE-0003354
ECHOBASE:
EB2501
OU-MICROARRAY:
b0993
PortEco:
torS
STRING:
511145.b0993
COLOMBOS: torS


Product      
Name: sensory histidine kinase TorS
Synonym(s): TorS, YccI
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 101.024
Isoelectric point: 5.258
Motif(s):
 
Type Positions Sequence
414 -> 414 A
685 -> 792 LLIEDNPLTQRITIEMLKTSGAQIVAVGNAAQALETLQNSEPFAAALVDFDLPDIDGITLARQLAQQYPSLVLIGFSAHVIDETLRQRTSSLFRGIIPKPVPREVLGQ
821 -> 914 GTEKIHEWLVLFTQHALPLLDEIDIARASQDSEKIKRAAHQLKSSCSSLGMHIASQLCAQLEQQPLSAPLPHEEITRSVAALEAWLHKKDLNAI
352 -> 403 VYRSVTRPLAEQTQALQRLLDGDIDSPFPETAGVRELDTIGRLMDAFRSNVH
408 -> 408 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0009061 - anaerobic respiration
GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
GO:0071310 - cellular response to organic substance
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Jourlin C., et al., 1996
[2] Moore JO., et al., 2009
External database links:  
DIP:
DIP-11017N
ECOCYC:
TORS-MONOMER
ECOLIWIKI:
b0993
INTERPRO:
IPR005467
INTERPRO:
IPR038188
INTERPRO:
IPR037952
INTERPRO:
IPR036890
INTERPRO:
IPR036641
INTERPRO:
IPR036097
INTERPRO:
IPR011006
INTERPRO:
IPR008207
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003660
INTERPRO:
IPR003594
INTERPRO:
IPR001789
MODBASE:
P39453
PANTHER:
PTHR43719:SF22
PDB:
3I9W
PFAM:
PF01627
PFAM:
PF00072
PFAM:
PF02518
PFAM:
PF00672
PFAM:
PF00512
PRIDE:
P39453
PRINTS:
PR00344
PRODB:
PRO_000024090
PROSITE:
PS50110
PROSITE:
PS50109
PROSITE:
PS50894
PROSITE:
PS50885
REFSEQ:
NP_415513
SMART:
SM00448
SMART:
SM00388
SMART:
SM00387
SMART:
SM00304
SMART:
SM00073
SMR:
P39453
UNIPROT:
P39453


Operon      
Name: torS         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1311 1053395 reverse nd [RS-EPT-CBR] [3]
  promoter torSp5 1056182 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter torTp7 1056207 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter torTp1 1056220 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter torTp2 1056222 forward Similarity to the consensus
Read more >
[ICWHO] [4]



RegulonDB