RegulonDB RegulonDB 10.9: Gene Form
   

rutB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rutA rutB rutR rutC NtrC NtrC PhoP RutR ArcA terminator anti-terminator anti-anti-terminator rutRp rutRp rutRp2 rutRp2 rutAp rutAp

Gene      
Name: rutB    Texpresso search in the literature
Synonym(s): ECK1002, G6522, b1011, ycdL
Genome position(nucleotides): 1072171 <-- 1072863 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.41
External database links:  
ASAP:
ABE-0003414
ECHOBASE:
EB3618
ECOLIHUB:
rutB
OU-MICROARRAY:
b1011
STRING:
511145.b1011
COLOMBOS: rutB


Product      
Name: peroxyureidoacrylate/ureidoacrylate amidohydrolase
Synonym(s): RutB, YcdL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.209
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
18 -> 215 SALIVVDMQNAYATPGGYLDLAGFDVSTTRPVIANIQTAVTAARAAGMLIIWFQNGWDEQYVEAGGPGSPNFHKSNALKTMRKQPQLQGKLLAKGSWDYQLVDELVPQPGDIVLPKPRYSGFFNTPLDSILRSRGIRHLVFTGIATNVCVESTLRDGFFLEYFGVVLEDATHQAGPKFAQKAALFNIETFFGWVSDVE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016811 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
biological_process GO:0006208 - pyrimidine nucleobase catabolic process
GO:0019740 - nitrogen utilization
GO:0006212 - uracil catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28106N
ECOCYC:
G6522-MONOMER
ECOLIWIKI:
b1011
INTERPRO:
IPR000868
INTERPRO:
IPR036380
INTERPRO:
IPR019916
MODBASE:
P75897
PFAM:
PF00857
PRIDE:
P75897
REFSEQ:
NP_415531
SMR:
P75897
UNIPROT:
P75897


Operon      
Name: rutABCDEFG         
Operon arrangement:
Transcription unit        Promoter
rutABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP, NtrC, ArcA
Repressed by: RutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB