RegulonDB RegulonDB 10.9: Gene Form
   

pgaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgaA pgaB dgcT pgaC NhaR NhaR OmpR ycdTp ycdTp TSS_1319 TSS_1319 pgaAp pgaAp

Gene      
Name: pgaA    Texpresso search in the literature
Synonym(s): ECK1014, G6531, b1024, hmsH, ycdS
Genome position(nucleotides): 1089866 <-- 1092289 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.32
External database links:  
ASAP:
ABE-0003469
ECHOBASE:
EB3625
ECOLIHUB:
pgaA
OU-MICROARRAY:
b1024
STRING:
511145.b1024
COLOMBOS: pgaA


Product      
Name: partially deacetylated poly-β-1,6-N-acetyl-D-glucosamine outer membrane porin
Synonym(s): HmsH, PgaA, YcdS
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 92.207
Isoelectric point: 6.561
Motif(s):
 
Type Positions Sequence
165 -> 198 KANLLAEAYIYKLAGRHQDELRAMTESLPENAST
27 -> 807 SPAAKSAVNNAYDALIIEARKGNTQPALSWFALKSALSNNQIADWLQIALWAGQDKQVITVYNRYRHQQLPARGYAAVAVAYRNLQQWQNSLTLWQKALSLEPQNKDYQRGQILTLADAGHYDTALVKLKQLNSGAPDKANLLAEAYIYKLAGRHQDELRAMTESLPENASTQQYPTEYVQALRNNQLAAAIDDANLTPDIRADIHAELVRLSFMPTRSESERYAIADRALAQYAALEILWHDNPDRTAQYQRIQVDHLGALLTRDRYKDVISHYQRLKKTGQIIPPWGQYWVASAYLKDHQPKKAQSIMTELFYHKETIAPDLSDEELADLFYSHLESENYPGALTVTQHTINTSPPFLRLMGTPTSIPNDTWLQGHSFLSTVAKYSNDLPQAEMTARELAYNAPGNQGLRIDYASVLQARGWPRAAENELKKAEVIEPRNINLEVEQAWTALTLQEWQQAAVLTHDVVEREPQDPGVVRLKRAVDVHNLAELRIAGSTGIDAEGPDSGKHDVDLTTIVYSPPLKDNWRGFAGFGYADGQFSEGKGIVRDWLAGVEWRSRNIWLEAEYAERVFNHEHKPGARLSGWYDFNDNWRIGSQLERLSHRVPLRAMKNGVTGNSAQAYVRWYQNERRKYGVSWAFTDFSDSNQRHEVSLEGQERIWSSPYLIVDFLPSLYYEQNTEHDTPYYNPIKTFDIVPAFEASHLLWRSYENSWEQIFSAGVGASWQKHYGTDVVTQLGYGQRISWNDVIDAGATLRWEKRPYDGDREHNLYVEFDMTFRF
279 -> 311 RIQVDHLGALLTRDRYKDVISHYQRLKKTGQII
98 -> 131 ARGYAAVAVAYRNLQQWQNSLTLWQKALSLEPQN
1 -> 26 MYSSSRKRCPKTKWALKLLTAAFLAA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0045203 - integral component of cell outer membrane
molecular_function GO:1901515 - poly-beta-1,6-N-acetyl-D-glucosamine transmembrane transporter activity
GO:0015159 - polysaccharide transmembrane transporter activity
biological_process GO:0015774 - polysaccharide transport
GO:0055085 - transmembrane transport
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Reference(s): [1] Agladze K., et al., 2005
[2] Samoilova Z., et al., 2019
[3] Wang Y., et al., 2016
External database links:  
ECOCYC:
G6531-MONOMER
ECOLIWIKI:
b1024
INTERPRO:
IPR011990
INTERPRO:
IPR013026
INTERPRO:
IPR019734
INTERPRO:
IPR023870
PDB:
4Y25
PRIDE:
P69434
PRODB:
PRO_000023520
PROSITE:
PS50005
PROSITE:
PS50293
REFSEQ:
NP_415543
SMART:
SM00028
SMR:
P69434
UNIPROT:
P69434


Operon      
Name: pgaABCD         
Operon arrangement:
Transcription unit        Promoter
pgaABCD


Transcriptional Regulation      
Display Regulation             
Activated by: NhaR
Repressed by: OmpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1319 1092840 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Agladze K., Wang X., Romeo T., 2005, Spatial periodicity of Escherichia coli K-12 biofilm microstructure initiates during a reversible, polar attachment phase of development and requires the polysaccharide adhesin PGA., J Bacteriol 187(24):8237-46

 [2] Samoilova Z., Tyulenev A., Muzyka N., Smirnova G., Oktyabrsky O., 2019, Tannic and gallic acids alter redox-parameters of the medium and modulate biofilm formation., AIMS Microbiol 5(4):379-392

 [3] Wang Y., Andole Pannuri A., Ni D., Zhou H., Cao X., Lu X., Romeo T., Huang Y., 2016, Structural Basis for Translocation of a Biofilm-supporting Exopolysaccharide across the Bacterial Outer Membrane., J Biol Chem 291(19):10046-57

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB