RegulonDB RegulonDB 10.9: Gene Form
   

insE4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF4 ycdU insF4 ymdE insE4 ycdUp11 ycdUp11 ycdUp1 ycdUp1 ycdUp9 ycdUp9 insFp4 insFp4 insFp5 insFp5

Gene      
Name: insE4    Texpresso search in the literature
Synonym(s): ECK0298, G6534, b1027
Genome position(nucleotides): 1095138 <-- 1095437 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0003477
ECOLIHUB:
insE-4
OU-MICROARRAY:
b1027
STRING:
511145.b2088
COLOMBOS: insE4


Product      
Name: IS3 element protein InsE
Synonym(s): InsE4
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.543
Isoelectric point: 10.57
Motif(s):
 
Type Positions Sequence
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
MONOMER0-4244
ECOLIWIKI:
b1027
INTERPRO:
IPR002514
INTERPRO:
IPR009057
PFAM:
PF01527
PRIDE:
P0CF69
REFSEQ:
NP_415546
UNIPROT:
P0CF69


Operon      
Name: insEF4E4F4         
Operon arrangement:
Transcription unit        Promoter
insE4F4EF4


RNA cis-regulatory element    
   
Cis-reg RtT RNA
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insFp5 1095155 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter insFp4 1095196 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp9 1095633 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp1 1095693 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycdUp11 1095759 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB