RegulonDB RegulonDB 10.8: Gene Form
   

ghrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ghrA ycdX serX Fis terminator TSS_1325 TSS_1325 TSS_1324 TSS_1324 TSS_1323 (cluster) TSS_1323 (cluster) ghrAp6 ghrAp6 TSS_1322 TSS_1322 TSS_1321 TSS_1321 serXp serXp TSS_1320 TSS_1320

Gene      
Name: ghrA    Texpresso search in the literature
Synonym(s): ECK1019, G6539, b1033, ycdW
Genome position(nucleotides): 1097886 --> 1098824 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.22
External database links:  
ASAP:
ABE-0003503
ECHOBASE:
EB3628
OU-MICROARRAY:
b1033
PortEco:
ghrA
STRING:
511145.b1033
COLOMBOS: ghrA


Product      
Name: glyoxylate/hydroxypyruvate reductase A
Synonym(s): GhrA, YcdW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 35.343
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
105 -> 277 SQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPESPLWQHPRVTITPHVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0016491 - oxidoreductase activity
GO:0030267 - glyoxylate reductase (NADP) activity
GO:0051287 - NAD binding
GO:0016618 - hydroxypyruvate reductase activity
biological_process GO:0033554 - cellular response to stress
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Grant GA. 2018
[2] Zhang N., et al., 2016
External database links:  
ECOCYC:
G6539-MONOMER
ECOLIWIKI:
b1033
INTERPRO:
IPR023514
INTERPRO:
IPR036291
INTERPRO:
IPR029753
INTERPRO:
IPR006140
MODBASE:
P75913
PFAM:
PF02826
PRIDE:
P75913
PRODB:
PRO_000022769
PROSITE:
PS00671
REFSEQ:
NP_415551
SMR:
P75913
UNIPROT:
P75913


Operon      
Name: ghrA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1320 1097652 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1321 1097759 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1322 1097787 forward nd [RS-EPT-CBR] [3]
  promoter ghrAp6 1097824 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_1323 (cluster) 1097825 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1324 1098858 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1325 1099543 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Grant GA., 2018, Elucidation of a Self-Sustaining Cycle in Escherichia coli l-Serine Biosynthesis That Results in the Conservation of the Coenzyme, NAD., Biochemistry 57(11):1798-1806

 [2] Zhang N., Wang J., Zhang Y., Gao H., 2016, Metabolic pathway optimization for biosynthesis of 1,2,4-butanetriol from xylose by engineered Escherichia coli., Enzyme Microb Technol 93-94:51-58

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB