RegulonDB RegulonDB 10.8: Gene Form
   

ycdX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ghrA ycdX ycdY CRP terminator TSS_1325 TSS_1325 TSS_1324 TSS_1324

Gene      
Name: ycdX    Texpresso search in the literature
Synonym(s): ECK1020, G6540, b1034
Genome position(nucleotides): 1098879 --> 1099616 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.37
External database links:  
ASAP:
ABE-0003508
ECHOBASE:
EB3629
OU-MICROARRAY:
b1034
PortEco:
ycdX
STRING:
511145.b1034
COLOMBOS: ycdX


Product      
Name: zinc-binding phosphatase YcdX
Synonym(s): YcdX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.89
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
5 -> 80 DLHMHTVASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHFINMRIWPRVVDGVGILRGIEANIKNVD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0042578 - phosphoric ester hydrolase activity
GO:0016791 - phosphatase activity
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
biological_process GO:0016311 - dephosphorylation
GO:0071978 - bacterial-type flagellum-dependent swarming motility
External database links:  
ECOCYC:
G6540-MONOMER
ECOLIWIKI:
b1034
INTERPRO:
IPR003141
INTERPRO:
IPR016195
INTERPRO:
IPR004013
INTERPRO:
IPR023710
MODBASE:
P75914
PDB:
1M68
PDB:
1M65
PDB:
1PB0
PFAM:
PF02811
PRIDE:
P75914
REFSEQ:
NP_415552
SMART:
SM00481
SMR:
P75914
UNIPROT:
P75914


Operon      
Name: ycdXY         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1324 1098858 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1325 1099543 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB