RegulonDB RegulonDB 10.8: Gene Form
   

ycdZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgG ycdY ycdZ CRP CytR CRP terminator ycdZp4 ycdZp4

Gene      
Name: ycdZ    Texpresso search in the literature
Synonym(s): ECK1022, G6542, b1036, nupT
Genome position(nucleotides): 1100296 --> 1100787 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.86
External database links:  
ASAP:
ABE-0003514
ECHOBASE:
EB3631
OU-MICROARRAY:
b1036
PortEco:
ycdZ
STRING:
511145.b1036
COLOMBOS: ycdZ


Product      
Name: inner membrane protein YcdZ
Synonym(s): NupT, YcdZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 17.074
Isoelectric point: 9.282
Motif(s):
 
Type Positions Sequence
72 -> 92 ALAPHLEILGYVITGIVAFLM
123 -> 143 LVLPSLALGLIFGYAMKNSGL
8 -> 142 AITTGILSGIWGWVAVSLGLLSWAGFLGCTAYFACPQGGLKGLAISAATLLSGVVWAMVIIYGSALAPHLEILGYVITGIVAFLMCIQAKQLLLSFVPGTFIGACATFAGQGDWKLVLPSLALGLIFGYAMKNSG
99 -> 119 LLLSFVPGTFIGACATFAGQG
3 -> 23 ILLSIAITTGILSGIWGWVAV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Sernova NV., et al., 2012
External database links:  
ECOCYC:
G6542-MONOMER
ECOLIWIKI:
b1036
INTERPRO:
IPR009476
PFAM:
PF06496
PRIDE:
P75916
REFSEQ:
NP_415554
SMR:
P75916
UNIPROT:
P75916


Operon      
Name: ycdZ         
Operon arrangement:
Transcription unit        Promoter
ycdZ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, CytR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Sernova NV., Gelfand MS., 2012, Comparative genomics of CytR, an unusual member of the LacI family of transcription factors., PLoS One 7(9):e44194


RegulonDB