RegulonDB RegulonDB 11.0: Gene Form
   

csgG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

csgG ycdZ csgF terminator csgGp1 csgGp1

Gene      
Name: csgG    Texpresso search in the literature
Synonym(s): ECK1023, G6543, b1037
Genome position(nucleotides): 1100851 <-- 1101684
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.12
External database links:  
ASAP:
ABE-0003516
ECHOBASE:
EB3189
ECOLIHUB:
csgG
OU-MICROARRAY:
b1037
STRING:
511145.b1037
COLOMBOS: csgG


Product      
Name: curli secretion channel
Synonym(s): CsgG
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,periplasmic space,inner membrane
Molecular weight: 30.557
Isoelectric point: 7.41
Motif(s):
 
Type Positions Sequence Comment
1 -> 15 MQRLFLLVAVMLLSG
16 -> 277 CLTAPPKEAARPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKAERQNDILVKYRHMSVPPES UniProt: Curli production assembly/transport component CsgG.
34 -> 41 QSYKDLTH
41 -> 255 HLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQ
49 -> 58 IFVSVYNIQD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0062155 - curli secretion complex
GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0045203 - integral component of cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0098775 - curli assembly
GO:0098777 - protein secretion by the type VIII secretion system
GO:0044010 - single-species biofilm formation
GO:0071806 - protein transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Gonnet P., et al., 2004
[2] Hammar M., et al., 1995
[3] Juncker AS., et al., 2003
[4] Perry TN., et al., 2019
[5] Rao S., et al., 2020
[6] Robinson LS., et al., 2006
External database links:  
ALPHAFOLD:
P0AEA2
DIP:
DIP-9331N
ECOCYC:
G6543-MONOMER
ECOLIWIKI:
b1037
INTERPRO:
IPR005534
PDB:
6LQH
PDB:
7BRM
PDB:
6SI7
PDB:
6LQJ
PDB:
6L7C
PDB:
6L7A
PDB:
4UV2
PDB:
4UV3
PFAM:
PF03783
PRIDE:
P0AEA2
PROSITE:
PS51257
REFSEQ:
NP_415555
SMR:
P0AEA2
UNIPROT:
P0AEA2


Operon      
Name: csgDEFG         
Operon arrangement:
Transcription unit        Promoter
csgDEFG
csgDEFG
csgDEFG
csgDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, OmpR, IHF, RcdA, Cra, BasR, CsgD, BolA, MlrA
Repressed by: MqsA, FliZ, CpxR, H-NS, RcsAB, RstA, BtsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter csgGp1 1101755 reverse nd [ICWHO] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [2] Hammar M., Arnqvist A., Bian Z., Olsen A., Normark S., 1995, Expression of two csg operons is required for production of fibronectin- and congo red-binding curli polymers in Escherichia coli K-12., Mol Microbiol 18(4):661-70

 [3] Juncker AS., Willenbrock H., Von Heijne G., Brunak S., Nielsen H., Krogh A., 2003, Prediction of lipoprotein signal peptides in Gram-negative bacteria., Protein Sci 12(8):1652-62

 [4] Perry TN., Souabni H., Rapisarda C., Fronzes R., Giusti F., Popot JL., Zoonens M., Gubellini F., 2019, BAmSA: Visualising transmembrane regions in protein complexes using biotinylated amphipols and electron microscopy., Biochim Biophys Acta Biomembr 1861(2):466-477

 [5] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [6] Robinson LS., Ashman EM., Hultgren SJ., Chapman MR., 2006, Secretion of curli fibre subunits is mediated by the outer membrane-localized CsgG protein., Mol Microbiol 59(3):870-81

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB