RegulonDB RegulonDB 10.9: Gene Form
   

clsC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clsC opgC ymdB clsCp clsCp

Gene      
Name: clsC    Texpresso search in the literature
Synonym(s): ECK1032, G6551, b1046, ymdC
Genome position(nucleotides): 1106355 --> 1107776 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.7
External database links:  
ASAP:
ABE-0003551
ECHOBASE:
EB3634
ECOLIHUB:
ymdC
OU-MICROARRAY:
b1046
STRING:
511145.b1046
COLOMBOS: clsC


Product      
Name: cardiolipin synthase C
Synonym(s): ClsC, YmdC, cardiolipin synthase 3
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 53.666
Isoelectric point: 9.458
Motif(s):
 
Type Positions Sequence
125 -> 152 LNRRMHNKSFTVDGVVTLVGGRNIGDAY
274 -> 417 IMGSPSERIDIISSYFVPTRAGVAQLLRMVRKGVKIAILTNSLAANDVAVVHAGYARWRKKLLRYGVELYELKPTREQSSTLHDRGITGNSGASLHAKTFSIDGKTVFIGSFNFDPRSTLLNTEMGFVIESETLAQLIDKRFIQ
369 -> 369 H
130 -> 130 H
364 -> 391 SGASLHAKTFSIDGKTVFIGSFNFDPRS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0090483 - phosphatidylglycerol-phosphatidylethanolamine phosphatidyltransferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0008654 - phospholipid biosynthetic process
GO:0032049 - cardiolipin biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12712N
ECOCYC:
G6551-MONOMER
ECOLIWIKI:
b1046
INTERPRO:
IPR025202
INTERPRO:
IPR001736
INTERPRO:
IPR030871
MODBASE:
P75919
PFAM:
PF13091
PRIDE:
P75919
PROSITE:
PS50035
REFSEQ:
NP_415564
SMART:
SM00155
UNIPROT:
P75919


Operon      
Name: ymdAB-clsC         
Operon arrangement:
Transcription unit        Promoter
ymdA
ymdAB
ymdAB-clsC
ymdB
ymdB-clsC
clsC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB