RegulonDB RegulonDB 10.9: Gene Form
   

bssS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

solA bssS dinI anti-anti-terminator anti-terminator terminator bssSp1 bssSp1 bssSp2 bssSp2 bssSp bssSp TSS_1333 TSS_1333 solAp solAp yceOp7 yceOp7 yceOp8 yceOp8 yceOp1 yceOp1

Gene      
Name: bssS    Texpresso search in the literature
Synonym(s): ECK1045, G6557, b1060, yceP
Genome position(nucleotides): 1120701 <-- 1120955 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.1
External database links:  
ASAP:
ABE-0003594
ECHOBASE:
EB4081
ECOLIHUB:
bssS
OU-MICROARRAY:
b1060
STRING:
511145.b1060
COLOMBOS: bssS


Product      
Name: regulator of biofilm formation
Synonym(s): BssS, YceP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 9.664
Isoelectric point: 4.558
Motif(s):
 
Type Positions Sequence
11 -> 76 HPLVGWDISTVDSYDALMLRLHYQTPNKSEQEGTEVGQTLWLTTDVARQFISILEAGIAKIESGDF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer
Gene Ontology Terms (GO)  
biological_process GO:1900190 - regulation of single-species biofilm formation
GO:0090609 - single-species submerged biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Beloin C., et al., 2004
[2] Domka J., et al., 2006
External database links:  
ECOCYC:
G6557-MONOMER
ECOLIWIKI:
b1060
INTERPRO:
IPR025730
PFAM:
PF13991
PRIDE:
P0AB33
PRODB:
PRO_000022233
REFSEQ:
NP_415578
SMR:
P0AB33
UNIPROT:
P0AB33


Operon      
Name: bssS         
Operon arrangement:
Transcription unit        Promoter
bssS
bssS
bssS


Transcriptional Regulation      
Display Regulation             
Activated by: YhaJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yceOp1 1119511 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yceOp8 1119623 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yceOp7 1119632 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1333 1120934 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Beloin C., Valle J., Latour-Lambert P., Faure P., Kzreminski M., Balestrino D., Haagensen JA., Molin S., Prensier G., Arbeille B., Ghigo JM., 2004, Global impact of mature biofilm lifestyle on Escherichia coli K-12 gene expression., Mol Microbiol 51(3):659-74

 [2] Domka J., Lee J., Wood TK., 2006, YliH (BssR) and YceP (BssS) Regulate Escherichia coli K-12 Biofilm Formation by Influencing Cell Signaling., Appl Environ Microbiol 72(4):2449-59

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB