RegulonDB RegulonDB 10.9: Gene Form
   

dinI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrC bssS dinI NagC LexA anti-anti-terminator anti-terminator terminator dinIp dinIp bssSp1 bssSp1 bssSp2 bssSp2 bssSp bssSp TSS_1333 TSS_1333

Gene      
Name: dinI    Texpresso search in the literature
Synonym(s): ECK1046, G6558, b1061
Genome position(nucleotides): 1121242 <-- 1121487 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.97
External database links:  
ASAP:
ABE-0003599
ECHOBASE:
EB2536
ECOLIHUB:
dinI
OU-MICROARRAY:
b1061
STRING:
511145.b1061
COLOMBOS: dinI


Product      
Name: DNA damage-inducible protein I
Synonym(s): DinI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.949
Isoelectric point: 4.406
Motif(s):
 
Type Positions Sequence
14 -> 78 PAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDKQRISEILQETWESADDWF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  5 - cell processes --> 5.8 - SOS response
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0019899 - enzyme binding
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0009432 - SOS response
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-9445N
ECOCYC:
G6558-MONOMER
ECOLIWIKI:
b1061
INTERPRO:
IPR036687
INTERPRO:
IPR010391
MODBASE:
P0ABR1
PANTHER:
PTHR36572
PDB:
1GHH
PFAM:
PF06183
PRIDE:
P0ABR1
PRODB:
PRO_000022449
REFSEQ:
NP_415579
SMR:
P0ABR1
UNIPROT:
P0ABR1


Operon      
Name: dinI         
Operon arrangement:
Transcription unit        Promoter
dinI


Transcriptional Regulation      
Display Regulation             
Repressed by: NagC, LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1333 1120934 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB