RegulonDB RegulonDB 10.9: Gene Form
   

flgN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murJ flgN flgM flgNp1 flgNp1

Gene      
Name: flgN    Texpresso search in the literature
Synonym(s): ECK1055, G6562, b1070
Genome position(nucleotides): 1129414 <-- 1129830 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.2
External database links:  
ASAP:
ABE-0003632
ECHOBASE:
EB2531
ECOLIHUB:
flgN
OU-MICROARRAY:
b1070
STRING:
511145.b1070
COLOMBOS: flgN


Product      
Name: flagellar biosynthesis protein FlgN
Synonym(s): FlgN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.867
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
1 -> 128 MTRLAEILDQMSAVLNDLKTVMDQEQQHLSMGQINGSQLQWITEQKSSLLATLDYLEQLRRKEPNTANSVDISQRWQEITVKTQQLRQMNQHNGWLLEGQIERNQQALEMLKPHQEPTLYGANGQTST

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
biological_process GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6562-MONOMER
ECOLIWIKI:
b1070
INTERPRO:
IPR007809
INTERPRO:
IPR036679
PFAM:
PF05130
PRIDE:
P43533
PRODB:
PRO_000022649
REFSEQ:
NP_415588
SMR:
P43533
UNIPROT:
P43533


Operon      
Name: flgAMN         
Operon arrangement:
Transcription unit        Promoter
flgMN
flgAMN


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter flgNp1 1129914 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB