RegulonDB RegulonDB 10.8: Gene Form
   

ycfL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lpoB ycfL hinT thiK

Gene      
Name: ycfL    Texpresso search in the literature
Synonym(s): ECK1090, G6564, b1104
Genome position(nucleotides): 1162247 --> 1162624 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.47
External database links:  
ASAP:
ABE-0003731
ECHOBASE:
EB3204
OU-MICROARRAY:
b1104
PortEco:
ycfL
STRING:
511145.b1104
COLOMBOS: ycfL


Product      
Name: DUF1425 domain-containing protein YcfL
Synonym(s): YcfL
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.981
Isoelectric point: 7.629
Motif(s):
 
Type Positions Sequence
34 -> 124 VMESSLLAAGISAEKPFLSTSDIQPSASSTLYNERQEPVTVHYRFYWYDARGLEMHPLERPRSVTIPAHSAVTLYGSANFLGAHKVRLYLY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11540N
ECOCYC:
G6564-MONOMER
ECOLIWIKI:
b1104
INTERPRO:
IPR010824
INTERPRO:
IPR038483
MINT:
MINT-1305880
PFAM:
PF07233
PRIDE:
P75946
REFSEQ:
NP_415622
SMR:
P75946
UNIPROT:
P75946


Operon      
Name: hinT-ycfL-lpoB-thiK-nagZ-ycfP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB