RegulonDB RegulonDB 10.9: Gene Form
   

lpoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nagZ thiK lpoB ycfL TSS_1438 TSS_1438 TSS_1437 TSS_1437 TSS_1436 TSS_1436

Gene      
Name: lpoB    Texpresso search in the literature
Synonym(s): ECK1091, G6565, b1105, ycfM
Genome position(nucleotides): 1162638 --> 1163279 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.39
External database links:  
ASAP:
ABE-0003733
ECHOBASE:
EB3205
ECOLIHUB:
ycfM
OU-MICROARRAY:
b1105
STRING:
511145.b1105
COLOMBOS: lpoB


Product      
Name: outer membrane lipoprotein - activator of MrcB activity
Synonym(s): LpoB, YcfM
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 22.516
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
80 -> 93 WNGAMQPMVSKMLG
1 -> 26 MTKMSRYALITALAMFLAGCVGQREP
73 -> 209 PHIRHYDWNGAMQPMVSKMLGADGVTAGSVLLVDSVNNRTNGSLNAAEATETLRNALANNGKFTLVSAQQLSMAKQQLGLSPQDSLGTRSKAIGIARNVGAHYVLYSSASGNVNAPTLQMQLMLVQTGEIIWSGKGA
175 -> 183 YVLYSSASG
102 -> 105 VLLV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0031241 - periplasmic side of cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0008047 - enzyme activator activity
GO:0030234 - enzyme regulator activity
GO:0019899 - enzyme binding
biological_process GO:0009252 - peptidoglycan biosynthetic process
GO:0008360 - regulation of cell shape
GO:0043085 - positive regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Boes A., et al., 2019
[2] Egan AJ., et al., 2014
[3] Monton Silva A., et al., 2018
[4] Paradis-Bleau C., et al., 2010
[5] Typas A., et al., 2010
External database links:  
ECOCYC:
G6565-MONOMER
ECOLIWIKI:
b1105
INTERPRO:
IPR014094
PANTHER:
PTHR40593
PFAM:
PF13036
PRIDE:
P0AB38
PROSITE:
PS51257
REFSEQ:
NP_415623
SMR:
P0AB38
UNIPROT:
P0AB38


Operon      
Name: hinT-ycfL-lpoB-thiK-nagZ-ycfP         
Operon arrangement:
Transcription unit        Promoter
hinT-ycfL-lpoB-thiK-nagZ-ycfP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1436 1163603 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1437 1164943 forward nd [RS-EPT-CBR] [6]
  promoter TSS_1438 1165016 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Boes A., Olatunji S., Breukink E., Terrak M., 2019, Regulation of the Peptidoglycan Polymerase Activity of PBP1b by Antagonist Actions of the Core Divisome Proteins FtsBLQ and FtsN., MBio 10(1)

 [2] Egan AJ., Jean NL., Koumoutsi A., Bougault CM., Biboy J., Sassine J., Solovyova AS., Breukink E., Typas A., Vollmer W., Simorre JP., 2014, Outer-membrane lipoprotein LpoB spans the periplasm to stimulate the peptidoglycan synthase PBP1B., Proc Natl Acad Sci U S A 111(22):8197-202

 [3] Monton Silva A., Otten C., Biboy J., Breukink E., VanNieuwenhze M., Vollmer W., den Blaauwen T., 2018, The Fluorescent D-Amino Acid NADA as a Tool to Study the Conditional Activity of Transpeptidases in Escherichia coli., Front Microbiol 9:2101

 [4] Paradis-Bleau C., Markovski M., Uehara T., Lupoli TJ., Walker S., Kahne DE., Bernhardt TG., 2010, Lipoprotein cofactors located in the outer membrane activate bacterial cell wall polymerases., Cell 143(7):1110-20

 [5] Typas A., Banzhaf M., van den Berg van Saparoea B., Verheul J., Biboy J., Nichols RJ., Zietek M., Beilharz K., Kannenberg K., von Rechenberg M., Breukink E., den Blaauwen T., Gross CA., Vollmer W., 2010, Regulation of peptidoglycan synthesis by outer-membrane proteins., Cell 143(7):1097-109

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB