RegulonDB RegulonDB 10.8: Gene Form
   

ycfP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ndh nagZ ycfP ArcA ArcA ArcA ArcA Fis ArcA IHF NsrR IHF PdhR FNR ArcA IHF Fis FNR Fis TSS_1441 (cluster) TSS_1441 (cluster) TSS_1440 TSS_1440 ndhp ndhp TSS_1439 TSS_1439 TSS_1438 TSS_1438 TSS_1437 TSS_1437

Gene      
Name: ycfP    Texpresso search in the literature
Synonym(s): ECK1094, G6568, b1108
Genome position(nucleotides): 1165143 --> 1165685 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.59
External database links:  
ASAP:
ABE-0003740
ECHOBASE:
EB3208
OU-MICROARRAY:
b1108
PortEco:
ycfP
STRING:
511145.b1108
COLOMBOS: ycfP


Product      
Name: UPF0227 protein YcfP
Synonym(s): YcfP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.226
Isoelectric point: 6.605
Motif(s):
 
Type Positions Sequence
1 -> 177 MIIYLHGFDSNSPGNHEKVLQLQFIDPDVRLISYSTRHPKHDMQHLLKEVDKMLQLNVDERPLICGVGLGGYWAERIGFLCDIRQVIFNPNLFPYENMEGKIDRPEEYADIATKCVTNFREKNRDRCLVILSRNDEALNSQRTSEELHHYYEIVWDEEQTHKFKNISPHLQRIKAFK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48123N
ECOCYC:
G6568-MONOMER
ECOLIWIKI:
b1108
INTERPRO:
IPR029058
INTERPRO:
IPR022987
INTERPRO:
IPR008886
MODBASE:
P0A8E1
PANTHER:
PTHR35602
PFAM:
PF05728
PRIDE:
P0A8E1
REFSEQ:
NP_415626
UNIPROT:
P0A8E1


Operon      
Name: hinT-ycfL-lpoB-thiK-nagZ-ycfP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1437 1164943 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1438 1165016 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1439 1165531 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1440 1166052 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1441 (cluster) 1166069 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB