RegulonDB RegulonDB 11.0: Gene Form

lolD gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

lolE lolC ycfT nagK lolD terminator nagKp3 nagKp3 TSS_1454 TSS_1454 TSS_1453 TSS_1453 TSS_1452 TSS_1452 TSS_1451 TSS_1451 TSS_1450 TSS_1450 lolCp5 lolCp5 lolCp6 lolCp6 TSS_1449 TSS_1449 ycfTp11 ycfTp11 ycfTp9 ycfTp9

Name: lolD    Texpresso search in the literature
Synonym(s): ECK1103, G6574, b1117, ycfV
Genome position(nucleotides): 1176619 --> 1177320
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: lipoprotein release complex - ATP binding subunit
Synonym(s): LolD, YcfV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.438
Isoelectric point: 8.273
Type Positions Sequence Comment
42 -> 42 G UniProt: Loss of lipoprotein release when overexpressed..
84 -> 115 LRNQKLGFIYQFHHLLPDFTALENVAMPLLIG implicated in interaction with the LolC and LolE subunits
93 -> 93 Y Y → H: dominant negative mutation; no effect on the ATPase activity of the LolD subunit but impairs ATPase activity of LolCD(Y93H)E complex; impairs growth due to retention of Lpp in the inner membrane


Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0098797 - plasma membrane protein complex
molecular_function GO:0140306 - lipoprotein releasing activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0022857 - transmembrane transporter activity
biological_process GO:0042953 - lipoprotein transport
GO:0055085 - transmembrane transport
GO:0044873 - lipoprotein localization to membrane
GO:0044874 - lipoprotein localization to outer membrane
GO:0089705 - protein localization to outer membrane
Note(s): Note(s): ...[more].
External database links:  

Name: lolCDE         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycfTp9 1175325 reverse nd [ICWHO] [1]
  promoter ycfTp11 1175329 reverse nd [ICWHO] [1]
  promoter TSS_1449 1175350 forward nd [RS-EPT-CBR] [2]
  promoter lolCp6 1175374 forward nd [ICWHO] [1]
  promoter lolCp5 1175399 forward nd [ICWHO] [1]
  promoter TSS_1450 1176220 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1451 1177193 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1452 1177616 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1453 1178231 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1454 1178238 forward nd [RS-EPT-CBR] [2]
  promoter nagKp3 1178540 forward nd [ICWHO] [1]


 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
