RegulonDB RegulonDB 10.9: Gene Form
   

lolE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lolE lolC nagK lolD nagKp3 nagKp3 TSS_1454 TSS_1454 TSS_1453 TSS_1453 TSS_1452 TSS_1452 TSS_1451 TSS_1451 TSS_1450 TSS_1450

Gene      
Name: lolE    Texpresso search in the literature
Synonym(s): ECK1104, G6575, b1118, ycfW
Genome position(nucleotides): 1177320 --> 1178564 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.89
External database links:  
ASAP:
ABE-0003776
ECHOBASE:
EB3215
ECOLIHUB:
lolE
OU-MICROARRAY:
b1118
STRING:
511145.b1118
COLOMBOS: lolE


Product      
Name: lipoprotein release complex - inner membrane subunit
Synonym(s): LolE, YcfW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 45.344
Isoelectric point: 9.165
Motif(s):
 
Type Positions Sequence
2 -> 414 AMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRDAGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ
27 -> 239 SVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVR
25 -> 45 LISVISTIGIALGVAVLIVGL
317 -> 337 AIFVWYGLLAGLFGSLCGVII
275 -> 295 AMVLVIGVACFNIVSTLVMAV

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0098797 - plasma membrane protein complex
molecular_function GO:0140306 - lipoprotein releasing activity
GO:0005515 - protein binding
biological_process GO:0042953 - lipoprotein transport
GO:0044874 - lipoprotein localization to outer membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YCFW-MONOMER
ECOLIWIKI:
b1118
INTERPRO:
IPR025857
INTERPRO:
IPR011926
INTERPRO:
IPR011925
INTERPRO:
IPR003838
MINT:
P75958
PFAM:
PF12704
PFAM:
PF02687
PRIDE:
P75958
PRODB:
PRO_000023107
REFSEQ:
NP_415636
SMR:
P75958
UNIPROT:
P75958


Operon      
Name: lolCDE         
Operon arrangement:
Transcription unit        Promoter
lolCDE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1450 1176220 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1451 1177193 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1452 1177616 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1453 1178231 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1454 1178238 forward nd [RS-EPT-CBR] [1]
  promoter nagKp3 1178540 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB